(data stored in ACNUC7421 zone)

EMBL: CP000489.PE264

CP000489.PE264       Location/Qualifiers
FT   CDS_pept        complement(243957..244910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0267"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   eli:ELI_07940 putative bacteriophage-acquired protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68381"
FT                   /db_xref="GOA:A1AYN7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN7"
FT                   /protein_id="ABL68381.1"
FT                   /translation="MSKPWKGAAQRATAQDFVTAAEELGCEVAALEAVWQIEASGKPFR
FT                   SDGTLERRFEPHKLRKPEGNYKTSAALSFAAREAKFDAAYARNAEDAMRASSWGGPQIM
FT                   GFNANAAGYPTAGAMVEAMAASESEQIRAFVRLIKAWGLASALRSHDWRAFAARYNGNA
FT                   NVAEYSARIETAYQKLSGRASPVVLRSGDKGVAVRRLQYALGIDVDGSFGPDTDKAVRD
FT                   FQKRHGLTVDGVVGQRTWKALEGYSGIQPVKQPAAQDRIAQASEIVALASTAAGAMATV
FT                   GGALPESSVNLLIIAAAVIGIGALALHAFRKLRGVA"
     atgtcgaaac cctggaaagg ggcggcgcag cgcgcgaccg cccaagactt cgttactgcc        60
     gccgaggaac tcggttgcga ggtcgccgcc cttgaggcgg tctggcagat cgaggcgtcg       120
     ggcaagccct tccgctcgga cgggacgctc gagcgccggt tcgagcctca caagctgcgc       180
     aagcccgagg gcaactacaa gaccagcgcg gcgctgtcgt tcgccgcccg cgaggcgaag       240
     ttcgacgcgg cctatgcccg caatgccgag gatgccatgc gcgcgagcag ctggggcggg       300
     ccgcagatca tggggttcaa cgcgaatgcg gccggctatc ccaccgccgg cgcgatggtc       360
     gaggccatgg cggcatccga gagtgagcag atccgcgcct ttgtccggct gatcaaagca       420
     tgggggctgg cgtcggcgct gcgttcgcat gactggcgcg cattcgccgc ccgctacaac       480
     ggcaacgcca acgtggcgga atattccgcc cggatcgaaa ccgcatatca gaagctctcg       540
     ggcagggctt cgccggtcgt gctgcgctcg ggtgacaagg gtgtggcggt caggcggctg       600
     caatatgccc tcgggatcga tgtggacggc agcttcggcc cggacacgga caaggccgtg       660
     cgcgatttcc agaagcgcca tggcctgacc gtcgacggcg tggtggggca gcgcacgtgg       720
     aaggccctcg agggctattc gggcatccag cctgtcaagc agcccgcggc acaggatcgc       780
     atcgcccagg cgagcgagat cgtggcgctg gcctcgaccg ccgccggcgc gatggccacg       840
     gtcggcgggg cgctgccgga atcctcggtc aacctgctga tcatcgccgc cgccgtcatc       900
     ggcatcggcg cgctggcgct gcatgccttc cgcaagctgc ggggggtggc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page