(data stored in ACNUC7421 zone)

EMBL: CP000489.PE266

CP000489.PE266       Location/Qualifiers
FT   CDS_pept        complement(245264..245617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68383"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN9"
FT                   /protein_id="ABL68383.1"
FT                   /translation="MANSANLALPYLAASQAQKHVTHNEALRLLDGIVQLSAADRAVNT
FT                   PPGSPSPGTRYIVGGAPTGEWAGWDDSIALWADGSWFRMIPKPGWTCWVEDEGMFYVFD
FT                   GSGWVTLASTLGL"
     atggcaaact ccgccaacct cgcgctgccg tatctcgcgg catcgcaagc gcaaaagcac        60
     gtcacccata acgaggcgct ccggctgctc gacggcatcg tgcagctttc ggctgccgac       120
     cgggccgtaa acacgccgcc gggcagcccg tccccgggca cccgctacat cgtcggcggc       180
     gcgccgaccg gcgaatgggc aggctgggat gacagcatcg ccttgtgggc tgatggatcg       240
     tggtttcgga tgattccgaa gccgggctgg acctgctggg tcgaggacga gggcatgttc       300
     tatgtctttg acggctccgg ctgggtgacg ctggccagca cccttggcct ttga             354
//

If you have problems or comments...

PBIL Back to PBIL home page