(data stored in ACNUC7421 zone)

EMBL: CP000489.PE270

CP000489.PE270       Location/Qualifiers
FT   CDS_pept        complement(250964..251590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68387"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP3"
FT                   /protein_id="ABL68387.1"
FT                   /translation="MAFHEIRFPDNISRGARGGPRRMTQVVELSSGDEERNASWANSRR
FT                   VYDVSYGIRNADQLAEVVSFFEARNGRLYGFRFKDWSDYKSCSPMQVSHPADMALGVGD
FT                   GTRTEFQLRKFYISGSQSWTRIITKPVADTVRVAVNGVEQLSGWTVDTTTGVVTFANPP
FT                   AAGQQVRAGFQFDVPVRFDTDQLDLILDIERLGSIPSIPLIEVRR"
     atggcgttcc acgaaatccg ttttcccgac aacatcagcc ggggcgcacg tggcgggccc        60
     cggcgcatga cgcaggtggt cgagctttcc tcgggcgacg aggagcgcaa cgcctcgtgg       120
     gccaactccc ggcgcgtcta cgatgtcagc tatggcatcc gcaatgcgga ccaactggcc       180
     gaagtcgtgt cgttcttcga ggcccgcaac ggacggctct acggtttccg cttcaaggat       240
     tggtccgatt ataaatcctg ctcgcccatg caggtttcgc atccggcgga catggccctt       300
     ggggtcggag atggaacccg caccgagttt cagttgcgca agttctatat ctcgggctca       360
     caaagctgga cccgcatcat tacgaagccg gtggcggata ccgtccgcgt ggcggtcaac       420
     ggagtcgagc agctatccgg ctggacggtc gataccacga ccggcgtcgt caccttcgcc       480
     aacccgccgg ccgccggcca gcaagtgcgc gccggattcc agttcgacgt gcccgtgcgc       540
     ttcgacacgg accagctgga cctgatcctc gatatcgagc ggctcggctc gatcccttcc       600
     attccgctga ttgaggtgcg gcgatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page