(data stored in ACNUC7421 zone)

EMBL: CP000489.PE274

CP000489.PE274       Location/Qualifiers
FT   CDS_pept        complement(254938..255678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0277"
FT                   /product="ChaC family protein"
FT                   /note="PFAM: ChaC family protein; KEGG: mlo:mll2256 cation
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68391"
FT                   /db_xref="GOA:A1AYP7"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP7"
FT                   /protein_id="ABL68391.1"
FT                   /translation="MELSPPAGNLMSNCRPIVLSDDHVARVASAEEGLLHDPRWRMLED
FT                   ADLDLLADRLTRGRPRPIPVFAYGSLIWNPGFAVGGRRRATAIGWHRRFSISLDHFRGT
FT                   PERPGLMLALASGGSCEGLVLDIAEGTEAQSLRAILRRELVAHELSANACWIEVETDRG
FT                   REDALTFYADPVGTQLAELTVQEQAQRLARAAGAAGSGAEYLLRTARGLAEIGIHDDYI
FT                   WTLQQLVAEEIDAGTAEPEERPSE"
     atggaactgt cgccgcccgc aggaaacctt atgtccaatt gtcgccccat cgtgctgtcc        60
     gacgatcacg tcgcccgcgt ggcttcggcc gaggaggggc tgttgcacga tccgcgctgg       120
     cggatgctcg aggacgccga cctggacctg ctggccgaca ggctcacccg ggggcggccg       180
     cggcccatcc cggtctttgc ctacggctcg ctgatctgga accccggctt tgccgtcggc       240
     gggcgccgcc gcgccaccgc catcggctgg catcgccgct tttcgatctc gctcgaccat       300
     ttccgcggca cgcccgagcg gcccgggctg atgcttgcgc tcgcctcggg cggcagttgc       360
     gaggggctgg tcctcgacat cgccgaaggg accgaggcgc aatcgctccg cgccatcctg       420
     cggcgcgaac tcgtcgccca tgagctgtcc gccaatgcct gctggatcga ggtcgagacc       480
     gaccgcggcc gcgaggatgc gctgaccttc tatgccgacc cggttggcac gcaacttgcc       540
     gaactcacgg tccaggaaca ggcgcagcgg ttggcccgcg cggcaggtgc cgccggatcg       600
     ggcgccgagt atctgctgcg cacggcccgg gggctggcgg aaatcggcat ccatgacgac       660
     tatatctgga cgctccagca gctcgtggcc gaggaaatcg acgccggaac ggcagagccc       720
     gaggaacggc ccagcgaatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page