(data stored in ACNUC7421 zone)

EMBL: CP000489.PE275

CP000489.PE275       Location/Qualifiers
FT   CDS_pept        256203..257528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0278"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rxy:Rxyl_2255 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68392"
FT                   /db_xref="GOA:A1AYP8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP8"
FT                   /protein_id="ABL68392.1"
FT                   /translation="MAISILPGGPAMRDAFGRLPIDEAPLKPIHIVAAAAVLGGAVLDG
FT                   YVLGIVGPALSIARQEMQLSAISQGLIASSALIGVFIGGLFFGNLADRFGRRPVFGWNL
FT                   AAFIVLSVLQIFVQDVWQLVAIRLALGLAIGVEYAVGSSVLAEFSRRKGRGVLLGCFSI
FT                   GWQVGFTVAFVVGSFYDGDNWRMLLASSVIPALITFVLRMTLPETPMWLKAQGRDAEAR
FT                   AIVDKHFGSEYAIPDVDPNPHHASPRELFTAEIWRQTLYSGLFWFCQVGPFFGIFTFLA
FT                   PVLESLGLRDATAVDMSLNAIQIAGAVVGVFLLHWMSRRGFVIWTFVIVLLTFLALGLF
FT                   PQAPTWVVVALFATYMFVAPAANNIQFVYPPEIFDTHIRATGIGFSAAFSRISAAGVTY
FT                   LLSWLLQKFGFSATLVMMAGFPLLGLVLSIFWAPETKGKHLR"
     atggctatat cgatcttgcc cggcgggccc gcgatgcggg atgctttcgg gcggctgccg        60
     attgacgagg cgccgctgaa gccgatccac atcgtggcgg cggccgcagt gctgggcggg       120
     gcggttctgg acggctatgt gcttggcatc gtcgggccgg ccctgtccat cgccaggcag       180
     gaaatgcagc tttctgcgat cagccagggc ctgatcgcct ccagtgcgct gatcggcgtg       240
     ttcatcggcg ggctgttctt cggcaacctg gcggatcgtt tcggccgcag gccagtcttc       300
     ggctggaacc tggcagcgtt catcgtgctg tcggtgttgc agatcttcgt gcaggatgtc       360
     tggcaactgg tcgcgatccg gctggcgctg gggttggcga tcggcgtgga atatgccgta       420
     ggctcctcgg tgctggccga gttttcgcgc cgcaagggca ggggcgtgct gctgggctgc       480
     ttttccatcg gctggcaggt gggcttcacc gtcgccttcg tcgtcggttc gttctatgac       540
     ggcgacaact ggcgcatgct gctggcatcg agcgtgatcc cggcgctgat cacctttgtc       600
     ctgcggatga ccctgcccga aaccccgatg tggctgaagg cgcagggccg cgatgccgag       660
     gcgcgggcca tcgtcgacaa gcatttcggt tcggaatacg cgatccccga tgtcgatccg       720
     aacccccacc acgcctcccc gcgcgagctt ttcacggccg agatctggcg gcagacgctt       780
     tactccggcc tcttctggtt ctgccaggtc gggcctttct tcggtatctt caccttcctg       840
     gccccggtgc tcgaatcgct gggcctgcgg gatgcgaccg cggtcgacat gtcgctgaac       900
     gccatccaga tcgccggtgc ggttgtcggc gtcttcctgc tgcactggat gagccggcgc       960
     ggcttcgtga tctggacctt cgtgatcgtg ctgctgacct tcctggcgct gggcctgttc      1020
     ccgcaggcgc cgacctgggt cgtcgtggcg ctgtttgcga cctacatgtt cgtcgccccg      1080
     gccgcgaata acatccagtt cgtctatccg cccgagatct tcgacaccca tatccgcgcg      1140
     accggcatcg gcttctcggc cgccttctcg cggatatcgg cggcgggggt gacgtacctg      1200
     ctgtcctggc tgctgcagaa gttcggtttc tcggcgacgt tggtgatgat ggcgggcttt      1260
     ccgcttctcg gcctggttct gtccatattc tgggccccgg aaaccaaggg caagcacctg      1320
     cgctag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page