(data stored in ACNUC7421 zone)

EMBL: CP000489.PE276

CP000489.PE276       Location/Qualifiers
FT   CDS_pept        257705..259090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0279"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: ret:RHE_PF00188
FT                   putative transcriptional regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68393"
FT                   /db_xref="GOA:A1AYP9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP9"
FT                   /protein_id="ABL68393.1"
FT                   /translation="MTIWTPDPSGLHRPAYLSLAEQYARAIRDGMLPAGTRLPPQRRLA
FT                   DDLGLSVQTVSRAYEELIRRGLVVGEVGRGSFVLPPGSENTPPYLAERLGELIDLSILK
FT                   PVTERMHVETFREGLHWVAENLPVPAALSFRPSSVLPQHRQIAADWLRRGGIDAQPENI
FT                   TITDGATSAITTAVMSAVPAGDTLAAAALTHHLLMPLCKYLGLHLEGLPVDEDGIVPEA
FT                   LDHLARKGSLRALYMQPAAINPMAIMSSAERRAELAAIARRHDLLVIENDMLNVMIPDR
FT                   PPPMAALAPERVLHINGFTKTTLPGLRVAWLLSPARLASATANRHLVTNWMATPAMVEL
FT                   LSHWIGDGTVDRLILWQREALGARHRIAREVLGAAPFRAHPQSLHIWLELPPGRDEEEF
FT                   VAQARQRGVAVASGRAFRLSERGRRDAVRIALGSTGADELRRGLTLVAETLGGSAEPLL
FT                   PLI"
     atgacaatat ggacccctga tcccagcggc ttgcatcgcc cggcctatct ttcccttgcc        60
     gagcaatatg cgcgggcgat ccgcgacggc atgctgcctg ccggaacccg cctgccgccc       120
     cagcgccggc tggccgatga tctggggctg tcggtccaga ccgtctcgcg cgcctatgaa       180
     gagctgatcc gccgcggcct cgtggtcgga gaggtcgggc gcgggtcctt cgtgctgccg       240
     ccgggttccg agaatacgcc gccctatctg gccgagcggc tgggcgagct tatcgacctg       300
     tcgatcctca agcccgtgac cgagcggatg catgtggaga cctttcgcga ggggctgcat       360
     tgggtggccg agaacctgcc cgtgccggcg gcgctgtcct tccggcccag ctcggtcctg       420
     ccgcagcacc ggcagatcgc cgccgactgg ctgcgccgcg gcggcatcga tgcgcagccc       480
     gaaaacatca ccatcaccga cggcgccact tcggccatca ccaccgcggt catgagcgca       540
     gtgcccgccg gcgacacgct ggccgccgcg gcgctgaccc atcacctgct gatgccgcta       600
     tgcaagtatc tgggcctgca tctggagggt ctgccggtcg atgaagacgg catcgtgccc       660
     gaggcgctgg accatctggc gcgcaagggc agcctgcgcg cgctttacat gcagccggcg       720
     gcgatcaatc cgatggcgat catgagcagc gccgagcgtc gcgccgaact ggccgccatc       780
     gcccgccgcc acgacctgct ggttatcgag aacgacatgc tgaacgtgat gataccggac       840
     cgaccgccgc ccatggccgc cttggcgccc gagcgggttc tgcatatcaa cggctttacc       900
     aagaccacgc tgcccggcct gcgggtggcc tggctgctgt cgccggcgcg ccttgcctcg       960
     gccacggcca atcggcatct ggtgacgaac tggatggcca cccccgccat ggtcgagttg      1020
     ctgagccact ggatcggcga cggcaccgtg gaccggctga tcctctggca gcgcgaggcg      1080
     ctgggcgccc gtcaccgcat cgcgcgcgag gttctgggcg cggcgccgtt ccgcgcccat      1140
     ccgcaaagcc tgcatatctg gctggaactg cctcccggcc gcgacgaaga ggagttcgtg      1200
     gcccaggccc gccagcgcgg cgttgccgtc gcctcgggcc gggcctttcg gctgagcgag      1260
     cgcggcaggc gggatgcggt gcgaatcgcg ctcggctcga ccggggcgga tgagttgcgc      1320
     cggggcctta cgctggtggc cgagaccctg ggcggcagcg ccgaacccct gcttccgctg      1380
     atttga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page