(data stored in ACNUC7421 zone)

EMBL: CP000489.PE277

CP000489.PE277       Location/Qualifiers
FT   CDS_pept        259188..259973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0280"
FT                   /product="hydroxyectoine ABC transporter ATP-binding
FT                   protein / ectoine ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMb20427 putative amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68394"
FT                   /db_xref="GOA:A1AYQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ0"
FT                   /protein_id="ABL68394.1"
FT                   /translation="MDQPIIRIQNLRKSFGTLTVIDGLNFDVMKGEKLALIGPSGSGKT
FT                   TILRILMTLEDISGGRIEVCGEPLYHMQRSGAEVPADEAHLHKMRRHIGMVFQHFNLFP
FT                   HKSVLQNITLAPMLTKGEARAVAEKRARELLDMVGLSDKADYMPSQLSGGQKQRVAIAR
FT                   ALALQPQIMLFDEVTSALDPELVEEVLEVMKRLAAETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDKGRIVEQGPPAQIFTAPQEDRTKSFLRKIIAAGQRV"
     ttggaccagc cgatcattcg catccagaac ctgcgaaagt cctttgggac gctgaccgtc        60
     atcgacgggc tgaatttcga cgtgatgaag ggcgagaagc tggcgctgat cggcccctct       120
     ggctcgggca agaccaccat cctgcgcatc ctgatgacgc tcgaggatat ttcgggcggg       180
     cgcatcgagg tgtgcggcga gccgctttac cacatgcaac gaagcggcgc cgaggtgccg       240
     gcggacgagg cgcacctgca caagatgcgc cgtcacatcg gcatggtgtt ccagcatttc       300
     aacctgttcc cgcacaagtc ggtgctgcag aacatcacgc ttgcgccgat gctgaccaag       360
     ggcgaggctc gcgccgtagc cgaaaagcgc gcgcgcgagc ttctggacat ggtggggctg       420
     tccgacaagg ccgactacat gcccagccag ctttccggcg gccagaagca gcgcgtcgcc       480
     atcgcccgcg ccctggcctt gcagccccag atcatgctgt tcgacgaggt gacctcggcg       540
     ctggaccccg agcttgtcga ggaggtgctg gaggtgatga agcgcctggc cgccgagacc       600
     gacatgacca tgctgctggt cacccatgag atgggtttcg cccatgattt cgccgatcgc       660
     gtgctgttct tcgacaaggg ccgcatcgtc gagcagggcc cgcccgccca gatattcacc       720
     gcgccgcaag aggaccgcac gaagtccttc ctgcgcaaga tcatcgccgc aggacagcgc       780
     gtgtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page