(data stored in ACNUC7421 zone)

EMBL: CP000489.PE279

CP000489.PE279       Location/Qualifiers
FT   CDS_pept        260877..261533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0282"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: sme:SMb20429 putative amino acid ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68396"
FT                   /db_xref="GOA:A1AYQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ2"
FT                   /protein_id="ABL68396.1"
FT                   /translation="MGDWAGYLTLILMGAWVTVKLTLMGSALALVVAFVAGLGRISRHA
FT                   AVRWLATAYIEFFRGTSIFVQLFWIYFVLPMTGAELTPMQAGVMALGLNVGAYGAEVVR
FT                   GAILAVPRDQHEACVAVNLTRFQRMRHIILPQALPLMLPTFGNNAIELLKATSVVSLIS
FT                   LSDMTFQAQVVRSQTGSTLMPFVTILLLYFAMSSALSFGMRRLERRVTRGLDGVR"
     atgggcgact gggcaggata tctgacactc atccttatgg gggcctgggt cacggtcaag        60
     ctgaccctga tgggttcggc cctggcgctg gtcgtggcct tcgtcgccgg gctgggccgc       120
     atctcgcgcc acgccgcggt tcgctggctg gcgaccgcct atatcgagtt cttccgcggc       180
     acctcgatct tcgtgcagct gttctggatc tatttcgtgc tgccgatgac cggggcggaa       240
     ctgacgccga tgcaggcggg agtgatggcg ctggggctga acgtcggcgc ctatggggcc       300
     gaggtggtgc gtggcgccat cctggccgtg ccgcgtgacc agcacgaggc ttgcgtcgcc       360
     gtcaacctga cgcggttcca gcgcatgcgc cacatcatcc tgccgcaggc gctgccgctg       420
     atgctgccga ccttcggcaa caacgccatc gagcttttga aggccacctc ggtcgtctcg       480
     ctgatctcgc tctcggacat gaccttccag gcgcaggtgg tgcgctcgca gaccggcagc       540
     acgctgatgc ccttcgtcac catcctgctg ctgtatttcg cgatgtcctc ggcgctttca       600
     ttcggcatgc gccggctgga gcggcgggtg acgcgcgggt tggacggggt gcgctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page