(data stored in ACNUC7421 zone)

EMBL: CP000489.PE283

CP000489.PE283       Location/Qualifiers
FT   CDS_pept        263884..264861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0286"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: sme:SMb20433
FT                   putative cyclodeaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68400"
FT                   /db_xref="GOA:A1AYQ6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ6"
FT                   /protein_id="ABL68400.1"
FT                   /translation="MRPPVTILTETDLRALVPLDAKAVACIRDAFVALATKPVAMPPIL
FT                   RLDIPEHRGEVDVKTAYVPGLTHFAIKISPGFFGNPALGLPSTNGMMVVLSSRTGLVEA
FT                   LLLDNGYLTDVRTAAAGAVAADALARPDAATAAILGAGMQARMQLQALALVRRLTGVRV
FT                   WARDPAKAQAFAAEMTAILRIPVTAGASVAEAARDADLVVTTTPSESPILSAADIAPGT
FT                   HVTAMGSDAGHKNEIAPDLIAAAHYVADRLSQTRTLGELHHSPLVGRDFPELGQILAGQ
FT                   RPGRTDPAQITLADLTGTGIQDTAIATLALARAGKAGAGRTFTL"
     atgagaccgc ccgtgaccat cctgaccgag acggatctgc gcgccctggt gccgctggac        60
     gccaaggccg tcgcctgcat ccgcgacgcc ttcgtggcgc tggcgaccaa gcccgtcgcc       120
     atgccgccga tcctgcgcct ggacatcccc gagcatcggg gagaggtcga tgtcaagacc       180
     gcctatgttc cggggcttac gcatttcgcc atcaagatct cgcccggttt cttcggcaac       240
     ccggcgcttg gcctgccctc gaccaacggc atgatggtgg tgctgtcctc gcgcaccggg       300
     ctggtcgagg cgctgcttct ggacaacggc tatctgaccg acgtgcgcac cgccgccgcc       360
     ggggcggtgg ctgccgatgc gctggcccga ccggatgcgg ccacggcggc gatccttggt       420
     gccgggatgc aggcgcggat gcagttgcag gcgctggcgc tggtccggcg tctgaccggc       480
     gtgcgggtct gggcgcgcga tcccgccaag gcgcaggctt tcgcggccga aatgaccgcc       540
     atcctgcgca ttcccgtgac cgccggcgcc agcgtggccg aggctgcacg ggatgccgat       600
     ctggtggtca cgaccacgcc gtccgaaagc ccgatcctga gcgccgccga catcgccccc       660
     ggcacccatg tcaccgccat gggctcggat gccgggcaca agaacgaaat cgcgccggac       720
     ctgatcgccg ccgcccatta cgtcgccgac cgcctgtcgc agacccggac cttgggcgaa       780
     ctgcaccact cgccgctggt cgggcgggat ttccccgagc ttggccagat cctggccgga       840
     cagcgccccg gccggaccga tcccgcccag atcaccctgg ccgacctgac cggcaccggc       900
     atccaggaca ccgccatcgc caccctggcg cttgcccgcg cgggcaaggc cggggccggc       960
     cgcaccttca ccctgtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page