(data stored in ACNUC7421 zone)

EMBL: CP000489.PE285

CP000489.PE285       Location/Qualifiers
FT   CDS_pept        266068..267069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0288"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: sme:SMb20435
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68402"
FT                   /db_xref="GOA:A1AYQ8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ8"
FT                   /protein_id="ABL68402.1"
FT                   /translation="MQPAPSPIAATVDFAAPGVGHGFLRLPHSRDDAAWGSIMTPITVV
FT                   NNGEGPTALLTGANHGDEYEGPIALFDLAATVRAEDVTGRLIIVPAMNYPAFAAATRTS
FT                   PIDRGNLNRSFPGRPDGTVTQKIADYFQRVLLPMADVVLDFHSGGKTLDFLPYCAAHIL
FT                   PDKRQQAAAFDLVRAFGAPWSVRMLEIDAVGMYDTAAEEMGKVFVTTELGGGGTASART
FT                   AGIAKRGLRNLLVAAGVMRGEVAAQPTRWLDMPDADCFTFAEDGGLIEFLADLGDAVEK
FT                   GQPVARIFPVTRTGLAPVTVPAGRAGLMMARHFPGIVKPGDCVAVIGVEVDE"
     atgcagcctg cgccctcgcc catcgcggcg acggtggatt tcgcggcgcc gggggtcggc        60
     cacggcttcc tgcgcctgcc ccattcgcgc gacgacgcgg cctgggggtc gatcatgacc       120
     ccgatcaccg tggtcaacaa cggcgagggg ccgacggcac tgttgaccgg cgccaatcat       180
     ggcgacgaat acgaagggcc gatcgcgctg ttcgacctgg ccgcgaccgt cagggccgaa       240
     gacgtcaccg gccgcctcat catcgtgccg gcgatgaatt atccggcctt cgcggcggcc       300
     acccgcacct cgcccatcga ccggggcaac ctgaaccgca gctttccggg gcggccggac       360
     ggcacggtca cgcagaaaat cgcggactat ttccagcgcg tgctgctgcc gatggcggat       420
     gtggtgctgg atttccattc cggcggcaag acgctggatt tcctgcccta ttgcgccgcc       480
     catatcctgc ccgacaagcg gcagcaggcg gctgccttcg atcttgtgcg cgccttcggg       540
     gcgccatggt cggtcaggat gctcgagatc gacgcggtcg gcatgtatga caccgcggcc       600
     gaggaaatgg gcaaggtctt cgtcaccacc gaacttggcg gcggcggcac ggcgtccgcc       660
     cgcaccgccg ggatcgccaa gcggggcctg cgcaacctgc tggtcgcggc gggcgtgatg       720
     cggggcgagg tcgcggcgca gccgacgcga tggctcgaca tgcccgatgc ggattgtttc       780
     acctttgccg aggatggcgg gttgatcgag ttcctggccg atcttggcga tgccgtggaa       840
     aagggccagc ccgtcgcccg catctttccg gtgacgcgca ccggccttgc cccggtcacg       900
     gttcccgccg gccgcgccgg cctgatgatg gctcggcatt tccccggcat cgtgaaaccc       960
     ggcgattgcg tcgccgtcat cggcgtggag gtcgacgaat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page