(data stored in ACNUC7421 zone)

EMBL: CP000489.PE29

CP000489.PE29        Location/Qualifiers
FT   CDS_pept        24593..25312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0029"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_2586 ABC multidrug efflux transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68146"
FT                   /db_xref="GOA:A1AY02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY02"
FT                   /protein_id="ABL68146.1"
FT                   /translation="MPQDALSIQHVSHSFGRVPALKDVSLTVPRGGFTALLGVNGAGKT
FT                   TLFSLITRLYDNRSGRIEVAGHDLRRQPGAALARLGVVFQSRALDADLTVAQNLEYHAA
FT                   LHGIPRREARARSVEVLAQVDLSDRLHARVSALSGGQSRRAEIARALIHRPEILLLDEA
FT                   TVGLDVKSRAEVVALTRELVRGGVSALWATHILDEIRPEDGLVILHKGEVLARGNAGEI
FT                   GGDDLTATFLRLTGEPA"
     atgccgcagg acgcgctttc catccagcat gtcagccaca gcttcggccg cgtccccgcg        60
     ctgaaggacg tgtcgctgac cgtgccgcgc ggcggcttca ccgcgcttct gggcgtgaac       120
     ggcgctggca agaccacgct gttctcactg atcaccaggc tttacgacaa ccgctcgggc       180
     cggatcgagg tggcggggca tgacctgcgc cgccagcccg gcgcggcgct ggcgcggctg       240
     ggggtggtgt tccagtcccg tgcgctggat gccgacctga ccgtggcgca gaacctggaa       300
     tatcatgccg cgctgcatgg cattccccgg cgcgaggcgc gggcgcgcag tgtcgaggtg       360
     ctggcgcagg tcgatctgtc ggaccggctg catgccaggg tctcggcgct gtcgggcggg       420
     cagagccgcc gggccgagat cgcccgcgcc ctgatccacc gtcccgagat cctgcttctg       480
     gacgaggcga ccgtcggcct tgacgtgaaa tcccgcgccg aggtggtggc gctgacccgc       540
     gaactggtgc ggggcggggt ctctgcactg tgggccacgc atatcctcga cgagatccgg       600
     cccgaggacg ggctggtcat cctgcacaag ggcgaggtgc tggcgcgcgg caatgccgga       660
     gagatcggcg gcgacgacct gaccgccacc ttcctgcgcc tgaccgggga gccggcatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page