(data stored in ACNUC7421 zone)

EMBL: CP000489.PE290

CP000489.PE290       Location/Qualifiers
FT   CDS_pept        complement(272403..272990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68407"
FT                   /db_xref="GOA:A1AYR3"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR3"
FT                   /protein_id="ABL68407.1"
FT                   /translation="MGSILHEPPSDDHAESIGIPGHPRPMRRGCSWHRPGGPLHARCLR
FT                   DGDEGQAGPDRTTPPRHGWRAEARPLRDALRFPPAPFRRRPPFHQKSRTMLKKLTPDSV
FT                   SRSDRDQDRGFPLGIVVLASLAAVAATALAWLMGWGLPWLVATYCLTGSVALLGLAWHK
FT                   ASRPDSEERYENADAAETGHAPRRAAVSGRPR"
     atgggaagca ttctccatga gccgccatcc gacgatcatg ccgagagcat cggcattccc        60
     ggccatcctc gccccatgcg ccggggatgc tcctggcacc gaccgggtgg gcctttgcac       120
     gctcgatgcc tgcgggacgg ggacgaaggc caggccggtc ccgaccgcac caccccgccg       180
     aggcatgggt ggcgcgcaga agcgcggccg cttcgcgatg ccctgcggtt tccgcctgcg       240
     ccattccggc gccgtcctcc ctttcaccaa aagagccgaa ccatgctgaa gaaactcacg       300
     ccggatagcg tttcccgatc cgacagggat caagaccgcg gcttccccct tgggatcgtc       360
     gtccttgcgt ccttggcggc ggtcgcggcg acggctctgg cctggctgat gggctggggg       420
     ctgccgtggc ttgtcgcgac ctattgcctg accggctcgg tggccctgct ggggcttgcc       480
     tggcacaagg ccagccggcc cgacagcgag gagcgatacg aaaacgcgga tgcggcggaa       540
     accggccatg cgccgcgtcg agcggccgtg agcggccggc cccggtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page