(data stored in ACNUC7421 zone)

EMBL: CP000489.PE293

CP000489.PE293       Location/Qualifiers
FT   CDS_pept        complement(276190..278148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0296"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: rsp:RSP_3056 TonB dependent-iron
FT                   siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68410"
FT                   /db_xref="GOA:A1AYR6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR6"
FT                   /protein_id="ABL68410.1"
FT                   /translation="MAAPFTPRLILVAGAAAALALPALAQETVVLLDPITLRALDADGS
FT                   AADRGASQYVAAAELERARMGDLKDLFTGIASVSVGGAIPVAQKIFINGVDMLNLSVTV
FT                   DGVEQNNRAFHHVSANAIDPGLLKFVRVDAGVAAADAGPHAVAGAVVMETVDAADILED
FT                   GRSFGGNVRLSYGDNGRTFGRAATLAGQMGGFEWLGYLKSATGDDYQAGGGQTIRGSAA
FT                   DLQSVLLKLAHETPGGHRIELSGQRLRDDTLRPYRANIGHIEGGAPLPELRRYDTTRSS
FT                   WSLSYENTQAGGLWDPRFVIGRSESRVHVDQPTVMPPYVSKGDSDTFSAKLENRFHLSD
FT                   ANSVTAGIDWYDRSSTYSDPFGGLDENARNIGLYAQARLEPVERLDLSFGLRWDRQDFT
FT                   GTSGWKDTNSGFSGNASLAYGLTDALVLRAGASTVFGGIAIEDNYIFNGAWDYDTLRPA
FT                   RARNYTLGFDYEAGDLRLDGELFLTQVDNARGGTYRGIENFDFESRGYNLGLGYGWNGG
FT                   YLRASISDSRVSVNGNPASSYEALDFGAPLGRVFSIEAQHTPQGSAFTYGGSIEAAAKY
FT                   DRIEGDSDRTIPGYAVLNLFAEYAPEQVEALVLRAEVANLFDKDYADRATYGGDYATVT
FT                   PLREPGRTFSLVATKRF"
     atggccgcac ccttcacccc ccgcctgatc cttgttgccg gcgccgccgc ggcgctggcc        60
     ctgcccgcct tggcccaaga gaccgtggtc ctgctggacc cgatcaccct ccgcgcgctg       120
     gacgccgacg gtagcgccgc cgaccgcggc gccagccagt atgtcgcggc ggccgagttg       180
     gagcgggccc ggatgggcga cctgaaggac ctgttcaccg gcatcgcctc ggtctcggtc       240
     gggggcgcga tcccggtggc gcaaaagatc ttcatcaacg gcgtggacat gctgaacctg       300
     tcggtgacgg tggacggggt cgagcagaac aaccgcgcct tccaccatgt cagcgccaat       360
     gccatcgacc ccggcctgct gaaattcgtc cgcgtcgatg ccggcgtggc ggcggcggat       420
     gccggcccgc atgccgtggc cggcgcggtg gtgatggaaa cggtagacgc cgccgacatc       480
     ctcgaggacg ggcgcagctt cggcggcaat gtccgcctgt cctatggcga caacggccgg       540
     accttcggcc gcgcggcgac gctggccgga cagatgggcg gtttcgaatg gctgggctat       600
     ctgaaatcgg cgaccggcga cgactaccag gccgggggcg gccagacgat caggggctcg       660
     gccgccgacc tgcaaagcgt gctgctgaag ctggcccatg agacgcccgg aggccatcgg       720
     atcgagcttt ccggccagcg gctgcgcgac gatacgctgc gcccctatcg cgccaatatc       780
     ggccatatcg agggcggcgc ccccctgccc gaactgcgcc gctatgacac cacccgcagc       840
     agttggtcgc tgtcctacga gaacacgcag gctggcgggc tgtgggatcc gagattcgtc       900
     atcggccgct cggaaagccg ggtgcatgtc gaccagccga ccgtgatgcc gccctatgtc       960
     agcaagggcg acagcgacac tttctcggcc aagctggaaa accgctttca cctgtccgac      1020
     gccaacagcg tgacggcggg gatcgactgg tatgaccgtt ccagcaccta cagcgatcct      1080
     ttcggcgggc tggacgagaa cgcccgcaat atcggccttt acgcccaggc ccggctggag      1140
     ccggtcgagc ggctggacct gtcctttggc ctgcgctggg accggcagga ctttaccggc      1200
     accagcggtt ggaaggacac caactccggc ttcagcggca atgcctctct cgcctatggc      1260
     ctgaccgatg cgctggtgct gcgcgccggg gcctcgaccg tcttcggcgg catcgccatc      1320
     gaggacaact acatcttcaa cggcgcctgg gactacgaca cgctgcggcc ggcgcgggcg      1380
     cgcaactata cgctgggctt cgactacgag gcgggcgacc tgcggctgga tggcgagttg      1440
     ttcctgaccc aggtggacaa tgcccgcggc ggcacctatc gcggcatcga gaatttcgac      1500
     tttgaaagcc ggggctacaa tctcggcctg ggctatggct ggaacggcgg ctatctgcgg      1560
     gccagcattt cggacagccg ggtcagcgtg aacggcaacc ccgcctccag ctacgaggcg      1620
     ctggatttcg gcgcgccgct gggccgggtg ttttccatcg aggcgcagca cacgccccag      1680
     ggcagcgcct tcacctatgg cggcagcatc gaggccgcgg cgaaatacga ccggatcgag      1740
     ggcgactccg accgcaccat ccccggctat gcggtgctga acctgtttgc ggaatatgcg      1800
     ccggagcagg tcgaggcgct ggtgctgcgg gccgaggtgg cgaacctctt cgacaaggat      1860
     tacgccgacc gcgccaccta tggcggcgac tacgccaccg tcaccccgct acgcgaaccg      1920
     gggcgcacct tctcgctggt ggcgacgaag cggttctga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page