(data stored in ACNUC7421 zone)

EMBL: CP000489.PE295

CP000489.PE295       Location/Qualifiers
FT   CDS_pept        complement(279006..279965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0298"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4491 ferrichrome ABC transporter (permease)
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68412"
FT                   /db_xref="GOA:A1AYR8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR8"
FT                   /protein_id="ABL68412.1"
FT                   /translation="MPHERRARLALLVLALLALSAILAFMTLGARGNWGFVLPFRGKKL
FT                   LGLLLVGHAVACSTVLFQTVTANRILTPAIMGFDSLFVLCSTVLMALFGSTMVAGLDPR
FT                   LVFAGNVLLMVGASMALYLWLFGGEERSLHRLLLIGVVFGIFLRMLAEFVQRMLDPNEF
FT                   MVLSDMLFASFGTIPATLLGIASAMVAGVTLWLMPRLSRLDVIALGRPVAVNLGIRWRA
FT                   EVLAVLAAVSVLVAVSAALVGPVLFFGLIAASLAHLAVGQSAHRYLLPAASLIGVTMLV
FT                   GGQTVLERVFAFNTALGIIVEFAGGITFIALLIGKGRR"
     gtgccgcatg agcgtcgcgc aaggctggcc ctgctggtcc tggccctgct ggccctgagc        60
     gcgatcctcg ccttcatgac gctgggcgcg cgcggcaact ggggcttcgt gctgccgttt       120
     cgcggcaaga agcttttggg cctgctgctg gtcggccacg ccgtcgcctg ctcgacggtg       180
     ctgttccaga ccgtgaccgc gaaccgcatc ctgaccccgg cgatcatggg gttcgattcg       240
     ctgttcgtgc tgtgcagcac ggtgctgatg gctctgttcg gctcgaccat ggtggcgggg       300
     ctggacccac ggctggtctt tgccggcaac gtcctgctga tggtcggggc ctcgatggcg       360
     ctttacctgt ggcttttcgg cggcgaggaa cgcagcctgc accgcctgct gctgatcggc       420
     gtggtctttg gcatcttcct gcgcatgctg gcggaattcg tccagcgcat gctggacccg       480
     aacgagttca tggtgctgtc ggacatgctg ttcgccagtt tcggcaccat tcccgcaaca       540
     ctgctgggca tcgccagcgc catggtcgcg ggcgtgacgc tgtggctgat gccgcgcctg       600
     tcgcggctgg acgtgatcgc gcttggccgg ccggtggcgg tgaacctggg catccgctgg       660
     cgggccgagg tgctggcggt cctggcggcg gtctcggtgc tggtcgcggt ctcggcggcg       720
     ctggtcgggc cggtgctgtt cttcggcctg atcgcggcca gcctggcgca tctggcggtc       780
     gggcaatcgg cgcatcgcta cctgctgccc gccgcctcgc tgatcggcgt caccatgctg       840
     gtcggcggcc agaccgtgct ggagcgggtc tttgccttca ataccgcgct tggcatcatc       900
     gtcgaattcg ccgggggcat caccttcatc gcgctattga tcggaaaggg ccgccgatga       960
//

If you have problems or comments...

PBIL Back to PBIL home page