(data stored in ACNUC7421 zone)

EMBL: CP000489.PE296

CP000489.PE296       Location/Qualifiers
FT   CDS_pept        complement(279955..280911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0299"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4489 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68413"
FT                   /db_xref="GOA:A1AYR9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR9"
FT                   /protein_id="ABL68413.1"
FT                   /translation="MTRLAAAVLVTAGLALASLFVGVSNVSLRGILAGQELDWLVLVES
FT                   RLPRMLALLLSGASMAIAGLLTQIVIRNRFVEPANTGTMESAGLGLLVMTLVAPGAPVI
FT                   AKMAAGAGFAMAGTALFLAILRRVPLRDPMLVPLVGILLSGVIYAGTAFVAYRFDLIQT
FT                   VLAWTQGDLSGVLRGRYELLWLGATLAAVAWLAADRFTVAGLGRDIASSLGLAHGRVVA
FT                   LGLTIVSLVTAVVVVTVGMIPFLGLIVPNIVSLALGDNMRRAVPWVAVSGAALVLACDI
FT                   LGRVIRAPYEVPLGTVLGVLGSAVFLVLILRSRDRAA"
     atgacccggc tggcggcagc ggtgctggtg acggcagggc ttgccctggc aagcctgttc        60
     gtcggcgtat cgaatgtcag cctgcggggc atcctggccg ggcaggaact cgactggctg       120
     gtgctggtcg aaagccggct gccgcgcatg ctggccctgt tgctgtcagg cgcctcgatg       180
     gcgatcgccg ggctgctgac gcagatcgtg atccgcaacc gcttcgtcga gccggccaat       240
     accgggacga tggaatccgc ggggctgggc ctgctggtga tgacgctggt cgcgccgggc       300
     gcgccggtca tcgccaagat ggccgccggc gcgggctttg ccatggcggg cacggcgctg       360
     tttctggcca tcctgcgccg ggtgccgctg cgcgatccga tgctggtgcc gctggtcggc       420
     atcctgctga gcggggtgat ctatgccggc accgccttcg tcgcctatcg cttcgacctg       480
     atccagaccg tgttggcctg gacgcagggc gacctgtcgg gcgtgctgcg gggtcgctat       540
     gagctcttgt ggctgggcgc gaccctggcc gccgtcgcct ggctggccgc cgaccgcttc       600
     acggtcgcgg ggctgggccg ggacatcgcc agttcgctgg ggctggcgca tgggcgggtg       660
     gtggcgctgg gactgaccat cgtctcgctg gtgacggcgg tcgtggtggt gacggtgggg       720
     atgatcccat tcctcggcct gatcgtgccg aacatcgtca gccttgccct gggcgacaac       780
     atgcgccggg cggtgccctg ggtcgcggtc tcgggcgcgg cgctggtcct ggcctgcgac       840
     atcctgggcc gggtgatccg cgcgccctac gaggtgccct tgggcacggt gctgggcgtg       900
     ctgggcagcg ccgtgttcct ggtcctgatc ctgcggagcc gcgaccgtgc cgcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page