(data stored in ACNUC7421 zone)

EMBL: CP000489.PE30

CP000489.PE30        Location/Qualifiers
FT   CDS_pept        25309..26127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0030"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rsp:RSP_2587 ABC
FT                   multidrug efflux transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68147"
FT                   /db_xref="GOA:A1AY03"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR022403"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY03"
FT                   /protein_id="ABL68147.1"
FT                   /translation="MSRRLTPRMWLTAFLGIARRETLRFVNQRGRFLAALVRPLVWLFI
FT                   FAAGFRAVLGLSITPPYQTYVLYEVYVTPGLCAMIQLFNGMQSSLSMVHDRETGAMRTL
FT                   LVSPFPRWFLLASKLVAGVIVSIIQVYTFLAIAWFWDVRPPAIGYLAVLPALFLSGLML
FT                   GAMGLFLSSAIRQLENFAGVMNFVIFPMFFASSALYPLWRMNESSPLLHDICAVNPFTH
FT                   AVELVRFALYARFDLLSFSVVSGCLILFFAGAVVMYDPAKGLWARRKGGA"
     atgagccgcc gcctgacccc gcgcatgtgg ctgaccgcct ttctgggcat cgcccggcgc        60
     gagaccctgc gcttcgtcaa ccagcgcggc cgcttcctgg cggcgctggt gcggccgctg       120
     gtctggcttt tcatctttgc cgcgggtttc cgtgccgtgc tgggcctgtc gatcacgccg       180
     ccctatcaga cctatgtgct gtacgaggtc tatgtgacgc ccggtctttg cgcgatgatc       240
     cagttgttca acggcatgca aagctcgctc tcgatggtgc atgaccgcga gaccggggcg       300
     atgcgcacgc tgctggtcag cccgtttccg cgctggttcc tgctggccag caagctggtg       360
     gcgggggtga tcgtgtcgat catccaggtc tataccttcc tggccatcgc ttggttctgg       420
     gacgtgcgcc cgcccgccat cggctatctg gccgtgctgc cggcgctgtt cctgtccggg       480
     ctgatgctgg gggcgatggg gttgttcctg tcctccgcca tccgccagct ggaaaacttt       540
     gcgggggtga tgaatttcgt catcttcccg atgttcttcg cctccagtgc gctttacccg       600
     ctgtggcgga tgaacgaaag ctcgccgctc ctgcatgaca tctgcgcggt caatcccttc       660
     acccatgcgg ttgagttggt ccgctttgcc ctttacgcgc gcttcgatct tctgtccttc       720
     tcggtggtgt cgggttgcct gatcctgttc tttgcagggg ccgtcgtcat gtatgatccg       780
     gccaaggggc tttgggcccg gcgaaagggg ggagcatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page