(data stored in ACNUC7421 zone)

EMBL: CP000489.PE300

CP000489.PE300       Location/Qualifiers
FT   CDS_pept        284436..284876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0303"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   sme:SMa1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68417"
FT                   /db_xref="GOA:A1AYS3"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS3"
FT                   /protein_id="ABL68417.1"
FT                   /translation="MTMRSFPDRVRHALMFEIIGLAIITPAAAWLYDKPMLDMGVVGVG
FT                   AATLATVWTFVFNLGFDHAMRRWVGHVHKAVHHRLLHTVLFEFGLLVMLLPPMAWYLGM
FT                   TLWQTLLLDLFIVAFYLVYNFVFNVIYDRVFPLPEMPRGQPA"
     atgacgatgc gcagtttccc cgaccgggtg cggcatgcgc tgatgttcga gatcatcggc        60
     cttgcgatca tcaccccggc agccgcctgg ctttacgaca agccgatgct cgacatgggc       120
     gtggtggggg tcggggcggc gacgctggcc acggtctgga cctttgtctt caacctgggc       180
     ttcgaccacg ccatgcggcg ctgggtcggg catgtccaca aggcggtgca tcaccggctg       240
     ctgcataccg tgctgttcga attcggcctg ctggtcatgc tcttgccgcc gatggcctgg       300
     tatctgggca tgacgctgtg gcagacgctg ctgctggacc tgttcatcgt ggccttctac       360
     ctggtctaca atttcgtctt caacgtgatc tatgaccggg tgttcccgct gcccgaaatg       420
     ccgcgcgggc agccggccta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page