(data stored in ACNUC7421 zone)

EMBL: CP000489.PE302

CP000489.PE302       Location/Qualifiers
FT   CDS_pept        285838..286125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68419"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS5"
FT                   /protein_id="ABL68419.1"
FT                   /translation="MITERRAKMSDNSVCERQRPFLPGLARLLFGVLRRDKPSLSPCAD
FT                   RMAALDHPATRKALADLPSHLLRDIGVADMRSEAGTAPLQEGDALRRHLW"
     atgatcaccg aaaggagggc aaaaatgtcc gataattccg tatgcgagcg ccagcgtccc        60
     ttcctgccgg gcctggcccg gttgcttttc ggtgtgctgc gtcgcgataa gcccagccta       120
     tcgccttgcg ccgaccggat ggccgcgctg gaccatcccg cgacgcgcaa ggcgctggcc       180
     gatctgccgt cgcatctgct gcgcgacatc ggcgttgccg acatgcgcag cgaagccggg       240
     accgccccct tgcaggaagg cgacgcgctg cgccgtcacc tgtggtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page