(data stored in ACNUC7421 zone)

EMBL: CP000489.PE303

CP000489.PE303       Location/Qualifiers
FT   CDS_pept        complement(286535..288052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0306"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: sme:SMb20726 conserved hypothetical
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68420"
FT                   /db_xref="GOA:A1AYS6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS6"
FT                   /protein_id="ABL68420.1"
FT                   /translation="MSAFEFLMQGLGTAADPMMLLYALIGVTLGTAVGVLPGIGPALTV
FT                   ALLLPVTYRLDPAGSLIMFAGIYYGGMYGGSTTSILLNTPGESASIITALEGNKMARKG
FT                   RGGPALATAAIGSFIAGLIATLLLAFLAPSIVKLALVFGPREYFALMVLAFVTVSAAFG
FT                   DSALRGLTSLFLGLALACVGIDQLTGQARLSFGVPELLDGIEVTTMAVAMFAVGEALFI
FT                   AGQRVQVDDEVTAVKGSIWMNRRDWARSWKPWLRGTFIGFPIGAMPAGGAEIGTFLSYA
FT                   TEKKLTKHPEEFGNGAIEGVAGPEAANNASAAGTLVPLLTLGLPTSATAAIMLAGFQQF
FT                   GLQPGPLLFATNPTLVWGLIASLLIANAMLLVLNLPMIGLWVKLLTVPKPWLYAGILLF
FT                   ATLGTIGANPSAFELGMLLAFGVLGYVMRLFGYPIAPIVVGLILGPMAEQQLRRALAIS
FT                   QGDWTTLVQSPIAATLLGIAALALIVPLILRARGKGEVLSQLAGDED"
     atgagcgcat tcgaattcct gatgcagggg cttggcaccg ccgccgaccc gatgatgctg        60
     ctttacgcgc tgatcggcgt gacgctgggc accgccgtcg gcgtcctgcc cggcatcggc       120
     ccggcgctga ccgtggcgct tttgctgccc gtcacctacc ggctggaccc ggccggctcg       180
     ctcatcatgt tcgccggcat ctattacggc ggcatgtatg gcggctcgac cacctcgatc       240
     ctgctgaaca cgccgggcga aagcgcctcg atcatcaccg cgctggaagg caacaagatg       300
     gcccgcaagg gccgcggcgg ccccgcgctg gccacggccg ccatcggctc gttcatcgcc       360
     ggcctgatcg cgacgctgct tctggccttc ctcgcgccca gcatcgtcaa gctggcgctg       420
     gtcttcggcc cgcgcgaata tttcgcgctg atggtgctgg ccttcgtcac cgtctcggcc       480
     gcgttcggcg attcggccct gcgcgggctg acctcgctgt tcctgggcct ggcgctggcc       540
     tgcgtcggca tcgaccagct caccgggcag gcgcggttgt ccttcggggt gcccgagctg       600
     ctggacggga tcgaggtcac caccatggcc gtcgcaatgt tcgccgtggg cgaggcgctg       660
     ttcatcgccg gccagcgcgt gcaggtcgac gacgaggtga cggccgtcaa gggctcgatc       720
     tggatgaacc gccgcgactg ggcgcggtcg tggaagccct ggctgcgcgg cacgttcatc       780
     ggctttccca tcggcgccat gccggcgggc ggggccgaga tcggcacctt cctgtcctat       840
     gcgaccgaaa agaagctgac caagcacccc gaggaattcg gcaacggcgc catcgaaggc       900
     gtcgccggtc ccgaggccgc gaacaatgcc agtgccgccg gcacgctggt gcccctgctg       960
     acgctgggcc tgccgacctc ggccacggcg gcgatcatgc tggccggttt ccagcagttc      1020
     gggctgcaac cgggcccgct gcttttcgcc accaacccga cgctggtctg ggggctgatc      1080
     gcctcgctgc tgatcgcgaa cgcgatgctg ctggtgctga acctgccgat gatcgggctg      1140
     tgggtaaagc tgctgacggt gccgaaacct tggctctatg ccggcatcct gctgttcgcg      1200
     acgctgggca ccatcggcgc caatccctcg gccttcgagc tgggaatgtt gctggccttc      1260
     ggcgtgctgg gctatgtgat gcggcttttc ggctatccca tcgcgcctat cgtcgtcggc      1320
     ctgatccttg gcccgatggc cgagcaacag ttgcggcggg cgctggcgat cagccagggc      1380
     gactggacga cgctggtgca atcgcccatc gccgccacgc tcctggggat cgccgcgctg      1440
     gcgctgatcg tgccgctgat cctgcgcgcc cgcggcaagg gcgaggttct gagccagctt      1500
     gccggcgacg aggactga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page