(data stored in ACNUC7421 zone)

EMBL: CP000489.PE304

CP000489.PE304       Location/Qualifiers
FT   CDS_pept        complement(288056..288550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0307"
FT                   /product="putative tricarboxylic transport membrane
FT                   protein"
FT                   /note="KEGG: atc:AGR_C_4484 putative tricarboxylic
FT                   transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68421"
FT                   /db_xref="GOA:A1AYS7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS7"
FT                   /protein_id="ABL68421.1"
FT                   /translation="MSVSRYEPPRRRDTAALIIAAGLVVIGGVMLWDSARLADLGGYSG
FT                   VGPASVPRVVGFALMGLAVWTAVEALRGDFPQRAPQNALPVLWIVAGLAAQLMLLHVAG
FT                   FSIATGILFAFTARAFGKRNLATTIPIGIVVSFVVWAIFSQLLMLHLPAGPLEHLIFPR
FT                   G"
     atgagcgtca gccgctatga accgccgcgc cgccgggata cggcggcgct gatcatcgcc        60
     gccgggctgg tggtgatcgg cggcgtgatg ctgtgggaca gcgcacgcct tgccgatctg       120
     ggcggctatt ccggcgtcgg ccccgccagc gtgccgcgcg tcgtcggctt cgcgctgatg       180
     ggccttgcgg tctggaccgc cgtcgaggcg ctgcgcggcg atttccccca gcgggcgccg       240
     cagaacgccc tgccggtcct gtggatcgtg gcgggtctgg cggcgcaact gatgctgctg       300
     catgtcgcgg gcttttccat cgcgaccggc atcctcttcg cctttaccgc gcgggccttc       360
     ggcaagcgca acctggcgac gaccatcccc atcggcatcg tcgtttcctt cgtggtctgg       420
     gcgatcttct cgcaacttct gatgctgcac ctgcccgccg ggccgcttga gcatctgatc       480
     tttccgcggg gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page