(data stored in ACNUC7421 zone)

EMBL: CP000489.PE305

CP000489.PE305       Location/Qualifiers
FT   CDS_pept        complement(288547..289488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0308"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   sme:SMb20724 putative tricarboxylic transport membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68422"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS8"
FT                   /protein_id="ABL68422.1"
FT                   /translation="MKQFVLASLFAAATALPAMADYTIIAPANPGGGWDQTARTMQAVM
FT                   QEEGISKSVQVQNVPGAGGTIGLAQFASQNKGNPDALIVGGYVMVGAILTNNSPVSLKD
FT                   VTPIARLTGEYEAIVVPAASPIQDVAGLIEALKADPGAVSWAGGSAGGTDHIAVGLIAK
FT                   AAGVDPTKINYIAYSGGGEALAAILGNQVTAGISSLGEFEAQIQAGTLRLLAVTAPERL
FT                   EGVDAPTLQEAGLDVVLENWRMVAAAPGLSDEQKAKVTADIEKMAKSENWQKQLSDKGW
FT                   MDTYLAGPEFEAQLEQDVTSTEAILKDIGLVK"
     atgaagcaat tcgttctcgc cagcctgttc gcggccgcca cggccctgcc ggccatggcc        60
     gattacacca tcatcgcccc ggccaatccc ggcggcggct gggaccagac cgcgcgcacc       120
     atgcaggccg tgatgcaaga ggaaggcatc tcgaaatcgg tgcaggtcca gaacgtgccc       180
     ggcgccggcg gcaccatcgg gctggcgcag ttcgccagcc agaacaaggg caatcccgac       240
     gcgctgatcg tcggcggcta tgtcatggtc ggcgccatcc tgaccaacaa ctcgcccgtc       300
     tcgctcaagg acgtgacgcc catcgcgcgg ctgaccggcg aatacgaggc gatcgtggtc       360
     cccgccgcct cgcccatcca ggacgtcgcc gggctgatcg aggcgctgaa ggccgatccg       420
     ggcgcggtca gctgggccgg cggctcggcc ggcggcaccg accatatcgc cgtgggcctg       480
     atcgccaagg cggcgggcgt cgatccgacc aagatcaact acatcgccta ttccggcggc       540
     ggcgaggcgc tggcggcgat cctgggcaac caggtgacgg ccggcatttc ctcgctgggc       600
     gagtttgagg cccagatcca ggccggcacc ttgcgcctcc tggccgtgac cgcgcccgag       660
     cggctggagg gcgtcgatgc gccgaccctg caagaggccg ggctggacgt ggtgctggag       720
     aactggcgca tggtcgccgc ggcgccgggc ctgtcggacg agcagaaggc caaggtcacc       780
     gccgatatcg aaaagatggc caagtcggag aactggcaaa agcagctctc ggacaagggc       840
     tggatggaca cctacctcgc cggtcccgaa ttcgaggccc agcttgaaca ggacgtgacc       900
     tcgaccgagg cgatcctcaa ggacatcggt ctggtgaaat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page