(data stored in ACNUC7421 zone)

EMBL: CP000489.PE307

CP000489.PE307       Location/Qualifiers
FT   CDS_pept        290820..291491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0310"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sme:SMb20722 putative
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68424"
FT                   /db_xref="GOA:A1AYT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT0"
FT                   /protein_id="ABL68424.1"
FT                   /translation="MRILLVEDNLSLAEGLTALLRQSGYAVDVVHDGASAEALAAAESF
FT                   DLVILDLNLPQMDGLEVLRAMRARRNPAAVMILTARGAPEERVRGLDLGADDYLIKPFD
FT                   IGEFEARIRSLLRRQAGLRNSTVSFGDLVLDQTARSFLLAGQPLDLPARERGLLELLIM
FT                   RAGKVVARESIVQSLTSLEDDLSANAIEQYVSRLRKRLAPAGLTVRTARGIGYFLDRAE
FT                   P"
     atgcgtattc tgcttgtcga ggacaatttg tcgctggccg aaggcctgac cgcactgttg        60
     cggcaatcgg gctatgcggt ggacgtggtc catgacggcg cctcggccga ggccctggcg       120
     gcggcggaaa gcttcgatct ggtgatcctc gacctgaacc tgccgcagat ggacgggctc       180
     gaggtgctgc gcgccatgcg cgcgcggcgc aacccggcgg cggtgatgat cctgaccgcg       240
     cgcggcgcgc ccgaggagcg ggtgcgcggc cttgacctgg gcgccgacga ctatctcatc       300
     aagcccttcg acatcggcga gttcgaggcc cgcatccgct cgcttttgcg ccggcaggcg       360
     ggtttgcgca attccaccgt cagcttcggc gacctggtgt tggaccagac cgcgcgcagc       420
     tttctgctgg cgggccagcc gctggacctg ccggcgcggg aacgcgggct tctggagctg       480
     ctgatcatgc gcgccggcaa ggtggtggcg cgcgaatcga tcgtgcagtc cctgacctcg       540
     ctcgaggacg acctgtccgc caatgccatc gagcaatatg tgagccggct gcgcaagcgg       600
     ctggcgccgg ccgggctgac cgtcaggacg gcgcgcggca tcggctattt tctcgaccgg       660
     gcggagccgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page