(data stored in ACNUC7421 zone)

EMBL: CP000489.PE311

CP000489.PE311       Location/Qualifiers
FT   CDS_pept        295262..295834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0314"
FT                   /product="AmiS/UreI transporter"
FT                   /note="PFAM: AmiS/UreI transporter; KEGG: bpa:BPP1188
FT                   putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68428"
FT                   /db_xref="GOA:A1AYT4"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT4"
FT                   /protein_id="ABL68428.1"
FT                   /translation="MADRIPGNCPKRGRACAGGPMLTGFVLFYVGAVLFLNGLWLMGRI
FT                   ADREIVVINIVTALVSGAAVLHDAFGTGASAASIRNGALSLLFCTTYLWVAYNRLSGAD
FT                   GRGLGWFSLFVAVTTVPVFLRALAAAGSATELWLAANWAVWGVLWFMYFLLLALGRPIQ
FT                   RQTAWVTLLAGIFTGWLPGFLLLDGLI"
     atggctgatc gtattccggg caattgccca aagcgcggtc gggcttgtgc aggaggtcca        60
     atgcttaccg ggttcgtgct gttctatgtc ggtgccgtgc tgtttctcaa cggcctgtgg       120
     ctgatgggcc ggatcgccga tcgcgagatc gtcgtcatca acatcgtcac cgcgctggtt       180
     tcgggtgcgg cggtgctgca tgacgccttt ggcaccggcg cgagtgcggc gagcatccgc       240
     aacggtgcgc taagcctctt gttctgcacc acctatctgt gggttgccta taaccggctc       300
     agcggcgcgg atgggcgcgg ccttggctgg ttcagcctgt tcgtggcggt gacgaccgtg       360
     ccggtctttc tgcgcgcgct ggcggcggcg ggctcggcga ccgagctttg gctggcggcg       420
     aactgggccg tctggggcgt tctgtggttc atgtatttcc tgctgctggc gcttggccgc       480
     ccgatccagc ggcagaccgc ctgggtcacg ctgctggccg ggatattcac cggctggctg       540
     ccgggcttcc tgctgctgga cgggcttatc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page