(data stored in ACNUC7421 zone)

EMBL: CP000489.PE313

CP000489.PE313       Location/Qualifiers
FT   CDS_pept        complement(297929..298891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0316"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sil:SPO0853 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68430"
FT                   /db_xref="GOA:A1AYT6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT6"
FT                   /protein_id="ABL68430.1"
FT                   /translation="MTRPTLGAVAIGRNEGERLKACLRSLVPLCERVVYVDSGSRDDSV
FT                   AFARSLGVDVVELDTSVPFTAARARNAGAEALLAGGDLDLVQFVDGDCRVEPGWLEAGT
FT                   AAMQADPELGLVTGWRSEIHPTATVYNQMCEVDWHRPAGPIVACGGDMMVRAAAFRRIG
FT                   GFDPTVIAAEDDEFCLRLGKAGWKLVRLPVQMTWHDADMTRFGQWWQRTIRNGHGFAQV
FT                   GRMHPPHFRREKLRVWAYGLVLPLVFLLGLFTSLWLSLAALGLYALSFWKTLKGLRGQP
FT                   MAARQAALLTLAKIPNLLGMLTYFRRRHRGVAMHIIEYK"
     atgacccgtc ccacgctggg cgcagtggcc atcggccgca acgagggcga gaggctgaag        60
     gcctgcctgc gctcgctggt gccgctttgc gagcgggtgg tctatgtgga cagcggctcg       120
     cgcgacgaca gcgtagcctt tgcccgcagc ctcggcgtcg acgtggtcga gctggacaca       180
     tcggttccct tcaccgccgc ccgtgcccgc aatgccgggg cagaggcgct gctggccggc       240
     ggcgatctgg atctggtgca attcgtcgat ggcgactgcc gggtcgagcc gggctggctg       300
     gaggccggca ccgccgccat gcaggccgat cccgaactgg gcctcgtcac cggctggcgg       360
     tccgagatcc accccacggc caccgtctac aaccagatgt gcgaggtgga ctggcatcgt       420
     cccgccggcc ctatcgtggc ctgcggcggc gacatgatgg tgcgcgcagc ggcgtttcgc       480
     cggatcggcg gcttcgaccc gacggtgatc gcggccgagg acgacgaatt ctgcctgcgc       540
     ctgggcaagg cgggctggaa gctggtgcgc ctgccggtgc agatgacctg gcacgacgcg       600
     gacatgaccc gctttggcca atggtggcag cgcaccatcc gcaacggcca cggctttgcg       660
     caggtgggcc gcatgcaccc gccgcatttc aggcgcgaaa agctgcgggt ctgggcctat       720
     gggctggtgt tgccgctggt ctttctgctg gggcttttca ccagcctctg gctgtcgctg       780
     gcggcgctgg ggctttacgc gctgtctttc tggaaaaccc tcaaggggct tcggggccag       840
     ccgatggcgg cgcggcaagc cgcgctgctg acgctggcca agatccccaa tcttctggga       900
     atgctgacat atttccgtcg ccgccatagg ggcgtcgcca tgcatattat cgagtataaa       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page