(data stored in ACNUC7421 zone)

EMBL: CP000489.PE316

CP000489.PE316       Location/Qualifiers
FT   CDS_pept        301221..302456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68433"
FT                   /db_xref="GOA:A1AYT9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT9"
FT                   /protein_id="ABL68433.1"
FT                   /translation="MAESVTSPSAASAAARGGFMAAIFLMATSAIGPGFITQTATFTAK
FT                   LGAAFAFAILASIVIDFVVQLNIWRITALTKRNASDTANAAIPGAGYLLAILVLVGGLA
FT                   FNIGNIAGAGLGLNAMFGLEPKIGGALSAALAIGIFLSRRAGLLLDRSLIGLGLLMIAM
FT                   TVIVALVSNPPVGDAVRQMVLPEIVDFATITTIVGGTVGGYITYSGAHRLLDKGLVGEQ
FT                   NLAAVTRASLTGIAVTGVMRFILFLAILGVVASGVTLDLSGQAANPAAQAFAVVLGEWG
FT                   MRIFGLIFWAAAITSVIGAAYTSVSFLVAFRTMGDRDRNIATVIFIAISLAVYLSLGTA
FT                   PAAILVFVGGFNGLILPIGLTIFTYVGFARADLMGGHVYNRPLLIASAVVCALTWYMGF
FT                   NSIGPIFAFLSA"
     atggccgaat ccgtcacctc cccctctgcc gcctcggctg ccgcgcgcgg cggtttcatg        60
     gcggcgatct tcctgatggc gacctcggcc atcgggccgg gcttcatcac ccagaccgcg       120
     accttcacgg caaagctggg cgctgccttc gcctttgcca tcctcgcctc gatcgtgatc       180
     gacttcgtgg tgcagctgaa tatctggcgc atcaccgcgc tgaccaagcg caacgcctcg       240
     gacaccgcca acgccgccat tcccggcgcg ggctatctgc tggcgattct ggtgctggtc       300
     ggcgggctgg ccttcaacat cggcaacatc gccggcgcgg ggctgggcct caacgccatg       360
     ttcgggctgg agcccaagat cggcggcgcg ctgtcggcgg cgctggccat cggcatcttc       420
     ctgtcgcgtc gggccgggct gctgctcgac cgttcgctga tcgggctggg cctgctgatg       480
     atcgccatga cggtcatcgt cgccctggtc tctaacccgc cggtcggcga cgcggtgcgg       540
     cagatggtgc tgcccgagat cgtcgatttc gccaccatca ccaccatcgt cggcggcacc       600
     gtgggcggct acatcaccta ttccggcgcg catcgcctgc tggacaaggg gctggtcgga       660
     gagcagaacc tggccgccgt cacccgcgcc tcgctgaccg ggatcgcggt cacgggggtc       720
     atgcgcttca tcctgttcct ggccatcctg ggcgtcgtcg cgtcgggcgt gacgctggac       780
     ctgtccgggc aggctgcgaa ccccgccgcg caggcctttg cggtcgtgct gggcgaatgg       840
     ggcatgcgca tctttggcct gatcttctgg gccgccgcca tcacctcggt catcggcgcg       900
     gcctatacct cggtcagctt cctcgtcgcc ttccgcacca tgggcgaccg cgaccgcaac       960
     atcgcgacgg tgatcttcat cgccatctcg ctggcggtct atctgtcgct gggcacggcg      1020
     ccggccgcca tcctggtctt tgtcggcggc ttcaacgggc tgatcctgcc catcggcctg      1080
     accatcttta cctatgtcgg cttcgcacgg gccgacctga tgggcgggca tgtctacaac      1140
     cgcccgctgc tgatcgccag tgccgtggtc tgcgcgctga catggtatat gggcttcaat      1200
     tccatcggcc cgatctttgc cttcctgagc gcctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page