(data stored in ACNUC7421 zone)

EMBL: CP000489.PE317

CP000489.PE317       Location/Qualifiers
FT   CDS_pept        302525..303298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0320"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: pst:PSPTO_5378
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68434"
FT                   /db_xref="GOA:A1AYU0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU0"
FT                   /protein_id="ABL68434.1"
FT                   /translation="MTRNIDLNSDLGEGYGAWKMGDDATMLGIVSSANVACGFHAGDPL
FT                   TILVTVREAAARGVAVGAHVSYPDRVGFGRRPMDVTHAELAADVIYQIGALQGICASAG
FT                   TRVSYVKPHGALYNTIATDPRQGAAVIEGIKAVDPGLAMMGLAGTQILRQAAEAGLPTI
FT                   AEAFADRAYRPDGQLVSRREPGAVLHDPEAVAARMLRLATDGEVEAADGSVLHLHADSI
FT                   CVHGDSPGAVAMAARIREVLLAGGVSIAPAAGGAA"
     atgacccgca acatcgacct gaacagcgac ctgggcgagg gctatggcgc ctggaagatg        60
     ggcgacgacg ccaccatgct gggcatcgtc agctcggcca acgtcgcctg cggctttcac       120
     gccggcgatc cgctgaccat ccttgtcacc gtgcgcgagg cggcggcgcg gggcgtggcg       180
     gtcggcgcgc atgtctccta tcctgaccgg gtgggcttcg gccgccggcc tatggacgtg       240
     acccatgccg agctggccgc ggacgtgatc tatcagatcg gcgcgctgca aggcatctgc       300
     gccagcgccg gcacccgcgt cagctatgtc aagccgcatg gcgcgcttta caacaccatc       360
     gccaccgatc ccaggcaggg cgctgcagtg atcgagggca tcaaggccgt cgatccgggg       420
     ctggccatga tgggcctggc cgggacgcag atcctgcggc aagcggccga ggccggcctg       480
     cccaccatcg ccgaggcctt cgccgaccgc gcctaccgcc ccgacggtca gctcgtttcg       540
     cgccgcgagc cgggcgccgt gctgcacgac cccgaggccg tcgccgcccg catgctgcgc       600
     ctggcgaccg acggcgaggt cgaggcggcg gacggctcgg tcctgcatct gcacgccgac       660
     agcatctgcg tgcatggcga cagccccggc gccgtcgcca tggccgcccg catccgcgag       720
     gtgctgctgg cgggcggcgt ttccatcgcc ccggctgcgg ggggcgcggc atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page