(data stored in ACNUC7421 zone)

EMBL: CP000489.PE32

CP000489.PE32        Location/Qualifiers
FT   CDS_pept        26711..27313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0032"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   sit:TM1040_3754 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68149"
FT                   /db_xref="GOA:A1AY05"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY05"
FT                   /protein_id="ABL68149.1"
FT                   /translation="MSPVPAVILAGGLSTRMGGGNKALRMLAGETLLSRVIARLSPQCG
FT                   PLAINANGEPGQFEEYGLPVIADGIAGFAGPLAGVLAGMEWAAGEGADSVVSVSVDTPF
FT                   LPEDLVHRLREAAGRSGVAIAASPDDSGQLRDHPTCALWPVSLRGELRDALESGLHRIG
FT                   QFAAAHDPGRAVFDSRPVDPFLNLNTPEDLARAARLV"
     atgagcccgg tccccgccgt catcctggcc ggagggctgt cgacccgcat gggcggcggc        60
     aacaaggcgc tgcggatgct ggcgggagag acgttgctgt cgcgggtgat cgcccggctt       120
     tcgccgcaat gcgggccgct tgcgatcaat gccaatggcg agccggggca gttcgaggaa       180
     tacgggctgc cggtgatcgc ggatggcatc gccggtttcg ccggaccgct ggccggggtt       240
     ctggccggca tggaatgggc ggcgggcgag ggggccgaca gcgtggtcag cgtcagcgtc       300
     gatacgccct ttctgcccga ggatctggtg catcggctgc gcgaggcggc cggccgttca       360
     ggcgtcgcca tcgccgccag cccggacgac agcggccagt tgcgcgatca tccgacctgt       420
     gcgctttggc ccgtgtcgct gcgcggggaa ttgcgcgacg cgctggaatc cggcctgcac       480
     cggatcggcc agtttgcggc tgcgcatgat ccggggcggg cggtgttcga cagccgcccc       540
     gtggacccgt tcctgaacct caacaccccc gaggatctgg cccgcgccgc gcgcctggtc       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page