(data stored in ACNUC7421 zone)

EMBL: CP000489.PE323

CP000489.PE323       Location/Qualifiers
FT   CDS_pept        complement(309179..310213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0326"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mlo:mll2315
FT                   alkanal monooxygenase (bacterial liciferase alpha chain)
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68440"
FT                   /db_xref="GOA:A1AYU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU6"
FT                   /protein_id="ABL68440.1"
FT                   /translation="MKKIGVKKIGFLSFGHWSDEPASQARSAQDTLLQSIELAVAAEEL
FT                   GADGAYFRVHHYARQLASPFPLLAAVGARTQRIEIGTAVIDMRYENPLYMAEDAGAADL
FT                   ISQGRLQLGISRGSPEQVIEGWRYFGYTPAEEESDADMARRHAEVFLNVIEGHGFARPN
FT                   PRPMFPNPPGLLRIEPHSPGLRERIWWGAASNDTARWAAQLGMHLQSSTLKTDENGKPF
FT                   HVQQAEQIRAYREAWAAAGHEREPRVSVSRSIFPLMDDRDRMYFGRGGKEADQIGFIEE
FT                   TRSIFGRGYTAEPDRLIEELREDEAIAEADTLLLTVPNQLGVDYNAHVIEAVLSHVAPA
FT                   LGWR"
     gtgaagaaga ttggcgtgaa gaagatcggt ttcctgtcct tcggccattg gtcggacgag        60
     cccgcctcgc aggcccgcag cgcccaggac acgctgctgc aatccatcga gctggccgtc       120
     gcggccgagg aactgggcgc ggacggcgcc tatttccgcg tgcatcatta tgcgcgccag       180
     ctggcctcgc cctttccgct gctggccgcg gtgggcgcgc gcacccagcg catcgagatc       240
     ggcaccgccg tcatcgacat gcgctatgaa aacccgctgt atatggccga ggatgccggg       300
     gcggccgacc tgatctcgca ggggcggctg cagcttggca tctcgcgcgg ctcgcccgag       360
     caggtgatcg agggctggcg ctatttcggc tataccccgg ccgaggagga aagcgacgcc       420
     gacatggccc ggcgccatgc cgaggtgttc ctgaacgtga tcgaggggca cggcttcgcc       480
     cggccgaacc cgcgcccgat gtttccgaac ccgccgggcc ttctgcggat cgagccgcat       540
     tcgccgggcc tgcgcgagcg gatctggtgg ggcgccgcct cgaacgacac cgcccgctgg       600
     gcggcgcagc tgggcatgca tctgcaaagc tcgacgctca agacggacga gaacggcaag       660
     cccttccacg tccagcaggc cgagcagatc cgcgcctatc gcgaggcctg ggcggcggct       720
     gggcatgagc gcgagccgag ggtctcggtc agccgctcga tctttccgct gatggacgac       780
     cgcgaccgga tgtatttcgg ccgcggcggc aaggaagccg atcagatcgg ctttatcgag       840
     gaaacccgct cgatcttcgg ccgcggctat actgccgaac cggaccggct gatcgaagag       900
     ttgcgcgagg acgaggccat cgccgaggcc gacaccctgc tgctgaccgt gccgaaccag       960
     ttgggcgtcg attacaacgc ccatgtgatc gaggcagtgc tgagccacgt cgcccccgcg      1020
     ctcggctggc gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page