(data stored in ACNUC7421 zone)

EMBL: CP000489.PE324

CP000489.PE324       Location/Qualifiers
FT   CDS_pept        complement(310210..311184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0327"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pau:PA14_48770 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68441"
FT                   /db_xref="GOA:A1AYU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU7"
FT                   /protein_id="ABL68441.1"
FT                   /translation="MRYDLNDLETFLTVMELGTVTAAAARLNLSKSVVSKRITDLEATL
FT                   GAALFRRNAGRITPTEAALRLAERLRPALAELIAAAESTAWDMDGLAPLRGSLSVAAPM
FT                   SFGVLHLGPIIARFAAQNPELEISVDYDDRSRDLAREGFDIGIRIGKMRDKALMQRKLC
FT                   EDASIACASPAYLDRKGRPQTLADLREHEVIGYSHLPNSQLWQFQDRDRFVSPFVQGRL
FT                   SMNNGEAIRDMTIEGLGLAMLPGFVVAPALADGRLERVLPGFGTRPLPIVAVWPPVQPM
FT                   PAKLRRFIDHLAVELSSPAWQAGWVSARRDPISQEPTTPKVAP"
     atgcgctatg acctgaacga tctggaaacc ttcctgacgg tgatggagct gggcaccgtc        60
     accgccgccg ccgcacggct gaacctgtcg aaatccgtgg tcagcaagcg gatcaccgac       120
     ctggaggcca cgttgggcgc ggcgctgttt cgccgcaatg ccggccgcat cacgccgacc       180
     gaggcggcgc tgcgcctggc cgagcggctg cgcccggcgc tggcggaact catcgcggcc       240
     gccgaaagca cagcctggga catggacggg ctggcacccc tgcgcggcag cctgtccgtc       300
     gccgcgccga tgagcttcgg cgtgctgcat ctggggccga tcatcgcccg cttcgccgcc       360
     cagaaccccg agctggagat cagcgtcgac tacgacgacc gcagccgcga cctggcgcgc       420
     gaaggcttcg acatcggcat ccgcatcggc aagatgcgcg acaaggcgct gatgcagcgc       480
     aagctgtgcg aggatgcaag catcgcctgc gccagccccg cctatctgga tcgcaagggc       540
     cgcccgcaga cgcttgccga cctgcgcgag catgaggtga tcggctacag ccacctgccg       600
     aacagccagc tctggcaatt ccaggaccgc gaccgcttcg tctcgccctt cgtgcagggg       660
     cggctgtcga tgaacaatgg cgaggcgatc cgcgacatga ccatcgaggg gctgggactg       720
     gccatgctgc ccggcttcgt cgtcgccccg gcgctggccg acgggcggct ggagcgggtg       780
     ctgcccggct tcggcacaag gccgctgccc atcgtcgcgg tctggccgcc ggtccagccg       840
     atgccggcca agctgcgccg cttcatcgac catctggcag tggaactgag cagcccggca       900
     tggcaggccg gctgggtatc cgcgcgccgc gaccccatat cccaggaacc cacaacccca       960
     aaggtcgccc cgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page