(data stored in ACNUC7421 zone)

EMBL: CP000489.PE326

CP000489.PE326       Location/Qualifiers
FT   CDS_pept        312401..312802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68443"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU9"
FT                   /protein_id="ABL68443.1"
FT                   /translation="MSQSEKGTPASELIDARIRELGNWRGETLARLRALIHEADPEVVE
FT                   EWKWRGVPVWSHDGILCTGETYSQVVKMTFAKGAALEDPSGLFNASLEGNTRRAIDLRE
FT                   GERIKAEALKALIRAAVALNRARKKGRSK"
     atgagccagt cggaaaaggg aacgcctgcc tcggaactga tcgatgcgcg gatcagggaa        60
     ctgggcaact ggcgcggcga aacgctggcg cggctgcgcg ccctgatcca cgaggccgat       120
     cccgaggtgg tcgaggaatg gaaatggcgc ggcgtgccgg tctggtcgca tgacggcatc       180
     ctctgcaccg gcgagaccta cagccaggtg gtcaagatga ccttcgccaa gggcgcggcg       240
     ctggaggatc cctcgggcct gttcaacgcc agccttgagg gcaacacccg ccgcgccatc       300
     gacctgcgcg agggagagcg gatcaaggcc gaggcgctca aggcgctgat ccgcgccgcc       360
     gtggcgctga accgggccag gaaaaagggg cgatcgaagt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page