(data stored in ACNUC7421 zone)

EMBL: CP000489.PE328

CP000489.PE328       Location/Qualifiers
FT   CDS_pept        complement(313684..315213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0331"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01956 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68445"
FT                   /db_xref="GOA:A1AYV1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV1"
FT                   /protein_id="ABL68445.1"
FT                   /translation="MPTGIHHVTGITRRVQANVDFYAGFLGLRLVKRTGGFEDAEQLHL
FT                   FYGDALGSPGSLVTFLVWEDGAPGRVGHGQVAEIALAVPPESIGDWLTRAMTARVPVEG
FT                   PLRERGETVLRLKDPDGVTVKLVGVDLPATAPLPDPIAPTRLRGATILTEQPQATRDFL
FT                   ARFGYRPGAAEGAVQRMESDTDTVDIRDATGFFPGIPGTGILDHVAFRAPDADAVRRMR
FT                   LELKDTDATTVHDRKYFLSLYVREPAGTLLEYATDAPGFTLDEAPEHLGETLFVPPHDA
FT                   ARADDLRVILPQFALPGEERSPMRELHFIHRFHRPESPDGSTIVLLHGTGGNESDLMPL
FT                   AHRMAPNATLLGVRGRSTEEGINRWFRRHDAVTYDQDDIRAETEAFAGFIDEAARAYAL
FT                   DPGALTYLGYSNGANLLGAAMQLHPGLIGRAVLLRAVQVLEEPPALDAQALAGSRVLML
FT                   TGARDPFARMAPALERALRDGGAALEARVIEAGHELQPEDLTLAAGWLAHD"
     atgcccaccg gcatccatca cgtcaccggc attacccgcc gggtgcaggc caatgtcgat        60
     ttctacgccg gcttcctggg cctgcgtctg gtcaagcgca cgggcgggtt cgaggatgcc       120
     gaacaattgc acctgttcta tggcgacgcg ctcggctcgc ccggctctct cgtcaccttc       180
     ctggtgtggg aggacggggc gccgggccgg gtcggccatg gccaggtggc ggaaatcgcg       240
     ctggccgtgc cgcccgaaag catcggcgac tggctgaccc gcgccatgac cgcccgcgtg       300
     ccggtcgagg ggccgctgcg cgagcggggc gaaaccgtgc tgcggctgaa ggaccccgac       360
     ggcgtcaccg tcaagctggt gggggtggac ctgcccgcga cggcgcccct gcccgatccc       420
     atcgcgccga cgcggctgcg cggcgcgacc atcctgaccg agcagccgca ggcgacgcgc       480
     gatttcctgg cccgtttcgg ctatcgcccc ggtgcggccg aaggcgcggt gcagcgcatg       540
     gaatccgaca cggataccgt cgacatccgc gacgcgaccg gattctttcc gggcattccc       600
     ggcaccggca tcctggatca cgtcgccttc cgcgcgccgg atgccgatgc ggtgcgccgg       660
     atgcggctgg agttgaagga taccgacgcg accaccgtgc acgaccggaa atatttcctg       720
     tcgctttatg tgcgcgagcc ggcgggaacg ctgctcgaat atgccaccga cgcccccggc       780
     tttaccctgg acgaggcgcc ggagcacctg ggcgagacgc tgttcgttcc gccccatgac       840
     gcggcccgcg ccgacgacct gcgcgtgatc ctgccgcaat tcgccctgcc gggcgaggaa       900
     aggagcccga tgcgcgagct gcatttcatc caccgcttcc accgaccgga gagcccggac       960
     ggcagcacca tcgtcctttt gcacggcacc ggcggcaacg aatccgacct gatgccgttg      1020
     gcccatcgca tggcgccgaa cgccacgctg ctgggcgtcc gcggccgctc gaccgaagag      1080
     ggcatcaacc gctggttccg ccgccatgac gccgtgacct atgaccagga cgacatccgc      1140
     gccgagaccg aggcctttgc cggcttcatc gacgaagccg cgcgggccta cgccttggac      1200
     cccggggcgc tgacctatct gggctattcc aacggcgcga acctgctggg ggcggccatg      1260
     caactgcatc cgggcctgat cggccgcgcg gtgctgctgc gcgccgtgca ggtgctggag      1320
     gaaccgccgg cgttggacgc gcaggccctg gccggcagcc gggtgctgat gctgaccggc      1380
     gcccgcgatc ccttcgcccg catggccccg gcgctggagc gcgcgttgcg cgacggcggt      1440
     gcggcgctgg aggcgagggt catcgaggcc gggcatgagc ttcagcccga ggatctgacg      1500
     ctggccgccg gctggctggc ccacgactga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page