(data stored in ACNUC7421 zone)

EMBL: CP000489.PE330

CP000489.PE330       Location/Qualifiers
FT   CDS_pept        complement(315957..316754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0333"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: rsp:RSP_0831 tryptophan synthase subunit
FT                   alpha; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68447"
FT                   /db_xref="GOA:A1AYV3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AYV3"
FT                   /protein_id="ABL68447.1"
FT                   /translation="MSRIDDTFARLSETGGKAFVAYMMGCDPDFDTSLQIMRGLPGAGV
FT                   DIIELGMPFTDPMADGATIQAAGQRALAAGGSVSRVLDMVRAFRRDDDATPIVLMGYYN
FT                   PIYARQGGVDRFITEAVEAGVDGLIVVDLPPEEDAELCLPAREAGLNFIRLATPTTDDR
FT                   RLPAVVRNTSGFVYYVSVTGITGGPAANAAEVAPEVARIRAAAKLPVVVGFGISTPEAA
FT                   QAVAGVADGCVVGSAIVKLIGEGRPVPEILSFVADLAQGAHSA"
     atgagcagaa tcgacgacac tttcgcgcgg ctgtccgaga cgggcggcaa ggccttcgtc        60
     gcctatatga tgggctgcga cccggatttc gacacctcgc tgcagatcat gcgcggcctg       120
     cccggcgcgg gcgtggacat catcgaactg ggcatgccct tcaccgaccc gatggccgac       180
     ggcgccacca tccaggcggc gggccagcgc gcgctggcgg ccggcggcag cgtcagcagg       240
     gtgctggaca tggtgcgcgc ctttcgccgg gacgacgatg ccacccccat cgtgctgatg       300
     ggctattaca acccgatcta tgcccggcag ggcggcgtgg accgcttcat caccgaggcg       360
     gtcgaggccg gcgtggacgg gctgatcgtc gtcgacctgc cgcccgaaga ggatgccgag       420
     ctgtgcctgc cggcacgcga ggccgggctg aacttcatcc gcctggcaac gccgacgacc       480
     gacgaccggc gcctgcctgc ggtggtgcgc aataccagcg gcttcgtcta ttacgtctcg       540
     gtcaccggca tcaccggcgg gcccgcagcc aatgccgcag aggtcgcgcc agaggtcgcc       600
     cgcatccgcg ccgccgccaa gctgccggtc gtcgtcggct tcggcatatc gacgccggag       660
     gcagcgcagg ccgtggcggg cgtcgccgat ggctgcgtcg tgggcagtgc catcgtcaag       720
     ctgatcggcg agggccgccc ggtgcccgag atcctgtcct tcgtcgcaga cctggcccag       780
     ggcgcgcaca gcgcctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page