(data stored in ACNUC7421 zone)

EMBL: CP000489.PE336

CP000489.PE336       Location/Qualifiers
FT   CDS_pept        complement(321356..322261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_3428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68453"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV9"
FT                   /protein_id="ABL68453.1"
FT                   /translation="MTSDIVSVEIGRSTWQGPAEEAPQRAEPITQGDLVSALEQIEILT
FT                   ATGSGLDPDTTMHIHLLAGIGRATHDPYAWYSRADLCASGQQVRALMDAAQTILDRGYV
FT                   SQSIAEEKPDHDALRDALAALTPAPQPEGPPDDLAVDRFAAAMKAKLAKKRTEGRGGWD
FT                   RKDECSAELLSRLLREHVEKGDPVDVGNLAMMLHQRGERIVPGGEAKSIAPQPEGEAVP
FT                   KCVACEDSPKPPNVPCAVCGAHPAQPGETVAAVERAFADIRELNMLDRDENGHRWANSD
FT                   LIDQTVTSGLIALRALKGGA"
     atgaccagcg acatcgtttc tgttgagatt ggccgcagca cctggcaggg cccggccgag        60
     gaagcaccgc agcgggcaga gcccatcacc caaggcgatc ttgtctctgc tctggagcag       120
     atcgagattc tgaccgccac cggctcgggg ctggacccgg acacgacgat gcatatccac       180
     ttgctcgcgg gcatcggccg ggcaacgcat gatccctatg cgtggtatag ccgcgccgac       240
     ctctgcgcct cgggccagca ggtgcgggcg ctgatggatg ctgcgcagac gatcttggat       300
     cggggatatg tgtctcaatc catcgcggaa gagaagccgg atcacgatgc cttgcgtgac       360
     gccctcgccg ccctgacgcc agccccgcag cccgaggggc cccccgacga tctggcagtt       420
     gaccgctttg ccgccgccat gaaagcgaag ctggcgaaga agcgtaccga aggccgtggc       480
     ggctgggatc gcaaggacga atgcagcgcc gagctgctgt cccgactgct gcgcgaacat       540
     gtcgaaaaag gcgatccggt cgatgtcggc aacctcgcca tgatgctgca tcagcgcggc       600
     gagcggatcg tgccgggtgg cgaagcgaaa agcatcgccc cgcagcccga gggagaggcg       660
     gtgccgaaat gcgtcgcctg tgaagatagc ccgaagcccc ctaatgtccc ttgcgcagtc       720
     tgtggtgccc acccggccca gcccggcgag acggtcgcgg cggtagaacg ggcttttgcc       780
     gatatccgtg aactgaatat gttggaccgc gatgagaacg ggcaccgctg ggccaactcc       840
     gacctgatcg accagaccgt gacatctggg ctgatcgccc tgcgcgccct gaaaggcggt       900
     gcgtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page