(data stored in ACNUC7421 zone)

EMBL: CP000489.PE337

CP000489.PE337       Location/Qualifiers
FT   CDS_pept        complement(322258..322677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68454"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW0"
FT                   /protein_id="ABL68454.1"
FT                   /translation="MKTIEQLTASETAWYSSNDTEVWHGGPYATREEAEDGAKAEEHEW
FT                   IMRATKWPVRVSEFFSQGCFFEAAEESLYDQCDEDGSPILDFTPAINLDLQSRVRAAID
FT                   EWQVAHQLSPMPWRFSGSDEPEIAAWAKAAEGGDA"
     gtgaaaacca tcgaacaact gacggccagc gagacggcct ggtattcctc gaatgacacg        60
     gaggtctggc acggcggtcc ctatgccacg cgcgaagagg ccgaggatgg cgccaaggcc       120
     gaggagcatg aatggatcat gcgagccact aaatggcccg tccgggtgtc ggaattcttc       180
     agccagggct gtttcttcga ggcagccgag gaatccctct atgaccagtg cgacgaggat       240
     ggatcgccga tcctggattt cacgcccgcc atcaacctcg acctgcaatc ccgcgtccgc       300
     gccgcaatcg acgaatggca ggtcgcgcat cagctttccc cgatgccctg gcggttcagc       360
     ggcagcgatg agcccgagat cgcggcctgg gcgaaagccg cggaaggcgg tgacgcatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page