(data stored in ACNUC7421 zone)

EMBL: CP000489.PE338

CP000489.PE338       Location/Qualifiers
FT   CDS_pept        complement(322674..325319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0341"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mes:Meso_1199 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68455"
FT                   /db_xref="GOA:A1AYW1"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW1"
FT                   /protein_id="ABL68455.1"
FT                   /translation="MGQHPSYDEFLRAKAAIAPRFGGMQVDEATLNPALKPHTRRMVSW
FT                   GLQGGRRAWFASFGLHKTATQLETMRVLTETTGQPTLITAPLGVRREFMREAQERFRGS
FT                   FAVDLKFIRDSDQVDGPGIYLTNYESVRDGKVQPDPFIGVSLDEAAILRGFGGTKTFRE
FT                   FMALFAGDDRRDQSNRIKTAGVPYRFVATATPSPNDYIELLSYAGFLDVMDIGQAKTRF
FT                   FKRNSEKADQLTLMQHKEREFWLWVASWALFVTKPSDLDPSFSDEGYDLPPLDVRWHEL
FT                   PVDHLAGAAVEKSGQKRMFKDVARDLKVAAREKRTSIGGRIEKLMEIRAEDPAAHRIIW
FT                   HDLEAERAALEKTVPGIATVYGSQDLDQREELIGDFADGRVQELGAKPVMLGSGTNLQR
FT                   HCAWHVFLGIGHKFNDFIQAIHRLLRFGQPADSVRLDLIYTEAEREIRRSLERKWRQHN
FT                   EMVQKMIDIIKEFGLSEVAMQQALVRALGVERVEASGPDYRCVHNDCVAETRSMPDASV
FT                   QLIVTSIPFSTQYEYSPNYADFGHTDDDPHFWQQMGFLIPELLRVLEPGRICAIHVKDR
FT                   IIPGGINGFGFQTLSTLHMDCVREFQRHGWAYLGMKTITTDVVRENNQTYRLGWSEQCK
FT                   DGSRMGCGVPEYLLIFRRPPSDTSNGYADRPVKKAKKEWDPEAKDWRNEGGYSRARWQI
FT                   DAHGYMRSNGDRTLLPEELEGLDADQVYKVWKAYNLQQVYDFEHHVRIGEALEKKGRLP
FT                   PTFMLLPPHSAHPDVWTDVARMMTINAEQARKGNEMHLCPLQYDIVDRAIAQFTERGEW
FT                   VYDPFGGLMTVPFRAVKLGRKGIGVELNKGYWLDGCKYVEAASREAGMPSLFDLLDADQ
FT                   PENQKLRRTA"
     atgggccagc atccttccta tgacgaattc ctgcgcgcca aggccgccat cgcgccgcgc        60
     ttcggcggca tgcaggtgga cgaggcgacc ctgaaccccg ccctgaaacc gcacacccgc       120
     cgcatggtga gctggggcct gcaaggcggc cggcgcgcat ggttcgccag cttcggcctg       180
     cacaagaccg cgacgcagct ggagaccatg cgcgtgctga ccgagacgac gggccagccg       240
     acgctgatca ctgcgccgct gggcgttcgg cgcgagttca tgcgcgaggc gcaggagcgg       300
     ttccggggct cctttgccgt ggacctgaaa ttcatccgcg acagcgatca ggtcgacggc       360
     ccgggcatct acctgaccaa ttacgaatcg gtgcgcgatg gcaaggtcca gcccgatccg       420
     ttcatcggcg tcagcctgga cgaggcggca atcctgcgcg gcttcggtgg caccaagacc       480
     ttccgggagt tcatggcgct attcgccggc gacgaccggc gcgaccagtc caaccggatc       540
     aagaccgccg gcgtccccta tcgcttcgtc gccaccgcca cgcccagccc gaacgattac       600
     atcgagctgc tgtcctacgc cggcttcctc gacgtgatgg atatcggcca ggccaagacc       660
     cggtttttca agcgcaacag cgagaaggcc gaccagctga ccctgatgca gcacaaggaa       720
     cgggaattct ggctgtgggt cgcgtcctgg gcgctgttcg tcactaagcc cagtgatctg       780
     gacccgtcgt tttcagacga gggctacgac ctgccgcccc tcgacgtgcg ctggcacgaa       840
     ctgccggtcg atcacctcgc cggcgccgcg gtcgagaaga gcggccagaa acgcatgttc       900
     aaggacgtcg cgcgcgatct gaaggtggca gcacgcgaaa aacgcaccag cattggcggt       960
     cggatcgaga agctgatgga gatccgcgcc gaggacccgg ccgcgcaccg gatcatctgg      1020
     cacgatctgg aggccgagcg cgccgcgctg gaaaagacgg tgcccggcat cgccacggtt      1080
     tacggttccc aggacctcga ccagcgcgag gagctgatcg gcgatttcgc cgatggccgg      1140
     gtgcaggagc tgggcgccaa gccggtgatg ttgggcagcg ggaccaacct gcaacggcac      1200
     tgcgcctggc acgtctttct cggcatcggt cacaagttca atgatttcat ccaggcgatc      1260
     caccgcctgc tgcggttcgg ccagcccgcc gacagcgtgc ggctcgacct gatctacacc      1320
     gaggctgaac gcgaaatccg ccgctcgctg gagcggaagt ggcgtcagca caacgagatg      1380
     gttcagaaaa tgatcgacat catcaaagag ttcggcctgt ccgaggtcgc gatgcagcag      1440
     gcgctggtgc gcgccttggg cgtcgagcgg gtcgaggcct cggggccgga ttaccgctgc      1500
     gtccacaacg attgcgtggc cgagacccgc agcatgcccg atgcctcggt gcagctgatc      1560
     gtcacctcga tcccgttcag cacccagtat gagtattcgc caaactacgc ggatttcggc      1620
     cacaccgacg acgatccgca tttctggcag cagatggggt tcctgatccc cgagctgctg      1680
     cgcgtgctgg agccgggccg gatctgcgcg atccacgtca aggaccggat catccccggt      1740
     ggcatcaacg gcttcggctt ccagacccta tcgaccctgc acatggattg cgtgcgcgag      1800
     ttccagcgcc acggctgggc ctatctcggt atgaagacca tcacgaccga tgtcgtgcgc      1860
     gagaacaacc agacctatcg cctgggctgg tcggaacagt gcaaggacgg cagccgcatg      1920
     ggctgcggcg tgccggaata cctgctgatc ttccgccggc cgcccagtga caccagcaac      1980
     ggctacgccg accggccggt gaagaaggcc aagaaggaat gggaccccga ggccaaggac      2040
     tggcgcaacg agggcggcta tagccgcgcc cgctggcaga tcgatgccca cggctacatg      2100
     cggtcgaatg gcgaccggac cctgctgccc gaggaactgg aggggctgga cgccgaccag      2160
     gtctacaagg tctggaaagc ctacaacctc cagcaggttt acgatttcga gcatcacgtc      2220
     cgaatcggcg aagcgctgga gaagaagggc cggctgccgc cgaccttcat gctcctgcca      2280
     ccgcatagcg cgcatcccga cgtgtggacc gatgtcgcgc gcatgatgac catcaacgcc      2340
     gagcaggcgc gcaagggcaa cgagatgcac ctgtgcccgc tgcaatacga catcgtcgac      2400
     cgggccatcg cccagttcac cgagcgcgga gaatgggtct acgacccgtt cggcgggctc      2460
     atgaccgtgc cgttccgcgc cgtgaaactc ggccgcaagg gcatcggggt cgaactgaac      2520
     aagggctatt ggctcgacgg ctgcaaatac gtcgaggccg cctcgcgcga ggccggcatg      2580
     cccagcctct tcgacctcct cgacgccgat caacccgaaa accagaaact gcggaggacc      2640
     gcgtga                                                                 2646
//

If you have problems or comments...

PBIL Back to PBIL home page