(data stored in ACNUC7421 zone)

EMBL: CP000489.PE339

CP000489.PE339       Location/Qualifiers
FT   CDS_pept        complement(325323..326441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0342"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /note="KEGG: jan:Jann_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68456"
FT                   /db_xref="GOA:A1AYW2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW2"
FT                   /protein_id="ABL68456.1"
FT                   /translation="MTLMEPIKPAATAGITCTVADLRRAVNAAAFVVERRNTIPVLGCL
FT                   RIEPLNDKLRIESTNLDSWLMVDCPATCIEGKPFVIDARLLLALLTGAERDDSVSITLD
FT                   GNVVTLRIGPAVARVQLLCPASDWPTAPSTKGMSWVSIPEAALARMIGRVRWAISTEET
FT                   RYYLNGIYMHGREGRLAVTATDGHRLALYHSDIEYKLPDLIFPRYSVAALCNLMTDGGN
FT                   QLLRIGGSADPVRMQISGDGWSLTVKCIDGAYPDYTRVIPDRGTMRGYAVINRALLRRF
FT                   PNTRRMHLLRDALKFDLDKRVANLNSVGLGIDVEIPIEADGDFAIGFNEGYVREVARIF
FT                   DTVRIEASTARDAALILTEDPDLTVVIMPMRM"
     atgaccctga tggagcccat caagcccgcc gccacggccg ggatcacctg caccgtcgcg        60
     gatctgcgcc gcgcggtgaa cgcggcggct ttcgtggtcg aacggcgcaa caccattccc       120
     gtcctcggat gcctgcgcat cgagccgctg aacgacaagc tgcggatcga aagcaccaac       180
     ctcgacagct ggctgatggt ggactgcccg gccacctgca ttgagggcaa gccattcgtg       240
     atcgacgcgc gcctgctgct cgcgctgctg accggcgccg agcgcgacga cagcgtcagc       300
     atcacgctgg acgggaatgt cgtgacgctg cggatcggcc cggcggttgc ccgcgtccag       360
     ctgctttgcc ccgcctcgga ttggccgacg gcacccagca ccaagggcat gtcgtgggtc       420
     agcataccgg aggcagcgct tgccaggatg atcggccgcg tgcggtgggc catctcgacc       480
     gaggagacgc gctattatct gaacggcatc tatatgcatg gtcgcgaggg gcgtctggcg       540
     gtcacagcga cggatggcca ccggctggcg ctgtatcatt ccgacatcga atacaaactg       600
     cccgatctga tcttcccacg ctactcggtg gccgcgctgt gcaacctgat gaccgacggc       660
     ggcaaccagc tgctgcggat cggcggctcg gcggatcccg tgcggatgca gatttcgggc       720
     gacggctggt cgctgacggt caaatgcatc gacggtgcct atcccgatta cacgcgggtc       780
     ataccggacc ggggcacgat gcgcggctat gccgtgatca atcgcgcctt gctgcggcgg       840
     ttcccgaaca ccaggagaat gcatctcctg cgtgacgccc tgaagttcga tttagacaag       900
     cgcgtcgcca acctgaacag cgtcggcctc gggattgatg tcgagatacc gatcgaagcc       960
     gacggggatt tcgccatcgg cttcaacgag ggctatgtcc gcgaggtcgc gcggatcttc      1020
     gacaccgtgc gcatcgaggc cagcaccgcg cgcgacgccg ccctgatcct gaccgaggac      1080
     cccgacctga cggtcgtcat catgccgatg cggatgtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page