(data stored in ACNUC7421 zone)

EMBL: CP000489.PE340

CP000489.PE340       Location/Qualifiers
FT   CDS_pept        complement(326577..326789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68457"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW3"
FT                   /protein_id="ABL68457.1"
FT                   /translation="MQDAAAAKTMFVEGRDGLILDRHTGRELARVAVDKMTITEAQRIS
FT                   RAILAGLEAEYALDPRPDGPPLPKP"
     atgcaggacg cggccgccgc caagaccatg ttcgtcgagg gccgagatgg cctgatcctc        60
     gaccgccaca cgggccgcga actggcgcgc gtggcggtcg acaagatgac catcaccgag       120
     gcgcagcgca tctcgcgcgc gatactcgcc ggcctggaag ccgaatacgc actcgatcct       180
     cggcccgacg ggccgcctct gccgaagcca tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page