(data stored in ACNUC7421 zone)

EMBL: CP000489.PE342

CP000489.PE342       Location/Qualifiers
FT   CDS_pept        328067..328573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68459"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW5"
FT                   /protein_id="ABL68459.1"
FT                   /translation="MLSLTADCSPGWITAASVCLGPWTAFAPTCPLIRSAAISVSFLLN
FT                   PPPRRHNPKSILMSLICKIPDRPRSGLPSRQMSFTPPVGGRGRSVAARRRAHVHAQRDT
FT                   DGFLRRWSMLMIVSFSTAEACGQHFGVTKQTGCNWREGTHRPCGDAVDFAMQTLPRYAE
FT                   IMWGQ"
     atgctgtctc tgacagccga ctgttctcca ggttggataa cggcggccag tgtctgccta        60
     ggaccatgga ccgcgttcgc gcctacatgt ccgctaatcc ggtcggcagc gatttcagtg       120
     tcatttctcc tcaacccgcc gccacggcgg cacaacccca agagcatcct catgtccctg       180
     atctgcaaaa tccctgatcg tccccgatct ggcctgcctt cgcggcaaat gtccttcacg       240
     cccccggtcg ggggtcgcgg ccgctcggtt gctgcgcgtc gccgggcgca tgtccatgcg       300
     cagcgcgata ccgacggttt cctgcggcgc tggtcgatgc tgatgatcgt cagcttttcc       360
     acggccgagg cctgcggcca gcatttcggc gtgaccaagc agaccggctg caattggcgc       420
     gagggcacgc accgtccctg cggcgatgcg gtggatttcg ccatgcagac gctgccccgc       480
     tacgccgaaa tcatgtgggg gcagtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page