(data stored in ACNUC7421 zone)

EMBL: CP000489.PE343

CP000489.PE343       Location/Qualifiers
FT   CDS_pept        328573..329100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68460"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW6"
FT                   /protein_id="ABL68460.1"
FT                   /translation="MDEPDLKPLMGARLARTSEVIERGNAMTAQDTDNWAADEAAERDP
FT                   SDDLGRLFPREGVQHPISESAAWALCAPFVGLVRCNWRVKRVDTDLFEQAIKTWWECLR
FT                   KARLPEERLTCERMINALGLANGMDNRARASELAAENVERFMAHRKEMARVRSERKEAA
FT                   CVDAWRDFRSVP"
     atggacgaac ctgatctgaa gccgctgatg ggcgccaggc tggcgaggac ctcggaagtg        60
     attgaaaggg gtaatgctat gacagcacag gacacggaca actgggcggc agacgaagct       120
     gccgagcgcg atccttcgga cgacttgggc cggctgttcc cacgcgaagg tgttcagcac       180
     ccgatttcgg aaagcgcggc atgggctttg tgcgcgcctt tcgttggcct ggttcggtgc       240
     aactggcgcg tcaagcgggt ggataccgat ttgtttgaac aggccatcaa gacctggtgg       300
     gaatgcctgc gcaaggcccg cctgccggaa gagaggctga cctgcgaacg catgatcaac       360
     gcgctcggcc tggccaatgg catggacaat cgagcgcggg ccagtgagtt ggccgccgag       420
     aacgtcgagc gcttcatggc ccatcgcaaa gagatggctc gggtccggag cgagcggaaa       480
     gaggccgctt gcgtagatgc ctggcgtgat ttcaggagcg tgccttga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page