(data stored in ACNUC7421 zone)

EMBL: CP000489.PE347

CP000489.PE347       Location/Qualifiers
FT   CDS_pept        330301..330513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68464"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX0"
FT                   /protein_id="ABL68464.1"
FT                   /translation="MRTHRDRHGNAYRAGAREGVGDFLADLLALTPPSTHDDLKKLARN
FT                   VLARPKYRRVSQKTAMNGGPNVAKQ"
     atgagaacgc accgggatcg gcacggcaat gcttatcgcg cgggcgcccg tgagggcgtc        60
     ggcgatttcc ttgccgatct gctggcgctg acgccgccat cgacccatga cgacctgaaa       120
     aagctggccc gcaacgtgct ggcccggccg aaatatcggc gggtttccca gaaaaccgcg       180
     atgaatggag gtcccaatgt cgccaagcaa tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page