(data stored in ACNUC7421 zone)

EMBL: CP000489.PE353

CP000489.PE353       Location/Qualifiers
FT   CDS_pept        335488..335838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0356"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rsp:RSP_2072 putative phage-related holin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68470"
FT                   /db_xref="GOA:A1AYX6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX6"
FT                   /protein_id="ABL68470.1"
FT                   /translation="MSRLGRMPSRFAGADQAGQRLSRAFQHRDQQREAIAPWRRWYKTA
FT                   RWQRLRESVLIRDQFTCRKCGTIETDTSMLVGDHIVPHRGDPELFWSQANVQCLCKTCH
FT                   DRDKQAEERNHV"
     atgagcaggt tggggcggat gccctcgcgc ttcgccggtg ccgatcaggc cggccagcga        60
     ttgagccgtg ctttccagca ccgcgatcag cagcgcgagg ccatcgcgcc ctggcggcgc       120
     tggtataaga ccgcccgctg gcagcggctg cgcgaaagcg tgctgatccg cgaccagttc       180
     acctgccgga agtgcgggac catcgagaca gacacgtcga tgctggtcgg tgaccacatc       240
     gtgccgcatc gcggtgaccc ggagttgttc tggtcgcagg caaatgtcca atgcctctgc       300
     aagacctgcc acgaccggga caagcaggca gaggagcgca atcatgtatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page