(data stored in ACNUC7421 zone)

EMBL: CP000489.PE354

CP000489.PE354       Location/Qualifiers
FT   CDS_pept        335888..336148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68471"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX7"
FT                   /protein_id="ABL68471.1"
FT                   /translation="MDALPAGGSILVVMTWDRARIYREGIVIRRGAEIEARTVVVSMGA
FT                   KDIISRLTGALLPIIITADVRAYCPRPLLLRIEDLAARPLN"
     gtggatgcct tgccggctgg cggaagcatc cttgtagtca tgacgtggga ccgggcccgc        60
     atctatcgcg aagggatagt gatccgcagg ggcgctgaga tagaggctag gacggttgtg       120
     gtctcgatgg gcgctaaaga catcatcagt cgcctgaccg gcgctctcct gccgattatc       180
     atcaccgccg acgtgcgtgc ctattgcccg cgaccgctct tgctgcgcat cgaggatctg       240
     gcggctcgcc ccttgaactg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page