(data stored in ACNUC7421 zone)

EMBL: CP000489.PE355

CP000489.PE355       Location/Qualifiers
FT   CDS_pept        336322..336825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0358"
FT                   /product="Resolvase helix-turn-helix domain protein"
FT                   /note="PFAM: Resolvase helix-turn-helix domain protein;
FT                   KEGG: sit:TM1040_1626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68472"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX8"
FT                   /protein_id="ABL68472.1"
FT                   /translation="MSGEVFDLFGNPVRPGRGQKGRPPFEVTDKDRNKVKLLLAMGWSN
FT                   QRVANAIGVSLATLKRYFRAELTVRDQMRDRLEARRLELAMDLANAGNTAGMRELDRLI
FT                   MKNDQKLAAAKMTQADEAEREEERPTSRYVGKGEISRKRANALAAGETQSEWGSLLKPG
FT                   SYEN"
     atgtcgggcg aagttttcga cctgttcggc aaccccgttc gcccgggcag gggccagaag        60
     gggcgcccgc cattcgaggt cacggataaa gatcgcaata aagtcaagct gttgctggcg       120
     atgggatgga gcaaccagcg ggtggcgaat gccatcggcg tctcgttggc gacgctgaag       180
     cggtatttta gagccgagct gaccgtgcgg gaccagatgc gggaccggct ggaggcgcgg       240
     cggctggaac tggcgatgga cctggccaat gccggcaaca ccgccgggat gcgcgagctt       300
     gatcgcctga tcatgaagaa cgatcagaag ctggcggcgg cgaagatgac gcaggcagac       360
     gaggccgagc gggaagagga acggccgacc tcgcgctatg tcgggaaggg cgagatttcc       420
     cgcaagcggg ccaacgcgct ggcagccggc gagacccagt ccgaatgggg tagtctgctg       480
     aagccgggaa gctatgagaa ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page