(data stored in ACNUC7421 zone)

EMBL: CP000489.PE361

CP000489.PE361       Location/Qualifiers
FT   CDS_pept        342471..342965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68478"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY4"
FT                   /protein_id="ABL68478.1"
FT                   /translation="MLYACDLAWWRRYSGAAGFAGLKLGADPAVDRKPWGVRSIRVQQT
FT                   VDRILTDRPGVIGWGGNSGFHALNLAVQFGVRRIVLVGYDMQVEAGLHWHGAHEGMNNP
FT                   SQQSTARWRRIIDAAAPDLALLGVEVINASAVSALTAYPKIPLMEALHADHDLAVNRSA
FT                   D"
     gtgctctatg cctgcgacct ggcgtggtgg cgccgctaca gcggtgcggc cgggtttgcc        60
     ggcctgaagc tcggcgccga tcccgccgtg gatcgcaagc cctggggcgt ccggtcgatc       120
     cgggtgcaac agaccgtgga tcgcatcctg accgacaggc cgggcgtcat cggctggggc       180
     ggcaacagcg ggttccacgc gctgaacctt gcggttcagt tcggcgtccg acggatcgtc       240
     ctggtcggtt acgacatgca ggtcgaggcc gggctgcact ggcacggtgc gcatgagggc       300
     atgaacaacc cctcgcagca atcgacggcc cgctggcggc ggatcatcga tgccgccgcg       360
     cccgatctcg cgttgctcgg ggtcgaggtc atcaacgcca gcgcggtctc cgcgctgacg       420
     gcctatccga aaatcccgct gatggaggcg ctgcatgccg atcatgatct cgcggtcaac       480
     cgatctgccg attga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page