(data stored in ACNUC7421 zone)

EMBL: CP000489.PE362

CP000489.PE362       Location/Qualifiers
FT   CDS_pept        342934..343482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1619 phage conserved hypothetical
FT                   protein, phiE125 gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68479"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY5"
FT                   /protein_id="ABL68479.1"
FT                   /translation="MISRSTDLPIDLAAAKKVLRVDFDDDDDMIRDLIDGETRRYEDFA
FT                   RRIVAQTVFRFRSPGWFTRIPIDLDPIRSIAGVFYLDQAMQEVALASAAYRFVPCSQGG
FT                   YLGIYSDWPRPDLADVAFPVWFDVVAGADLPADSPAVAPLDPADRMNILHMVKQIYDHD
FT                   DPLTEEQLRRRFSGRRLLW"
     atgatctcgc ggtcaaccga tctgccgatt gacctggccg ccgccaagaa ggtgctgcgg        60
     gtcgatttcg acgatgacga cgacatgatc cgcgatctga tcgacggcga gacccggcgc       120
     tacgaggact tcgcgcggcg catcgtcgcg cagaccgtgt tccggttccg gtcgccgggc       180
     tggttcacgc gcataccgat cgatctcgat ccgatccgca gcatcgccgg cgtgttctat       240
     cttgaccagg ccatgcagga ggtcgcgttg gcctcggccg cctatcgctt cgtgccctgt       300
     tcgcagggcg gatacctggg catctactcg gactggcccc ggccggacct ggcggatgtc       360
     gcgtttccgg tctggttcga cgtggtcgcc ggtgccgatc tgccagccga cagccccgcg       420
     gttgcgccgc tcgatccggc cgaccggatg aacatcctgc acatggtcaa gcagatctac       480
     gaccacgacg atccgctgac cgaggagcag ttgcggcgcc ggttttccgg caggaggttg       540
     ctatggtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page