(data stored in ACNUC7421 zone)

EMBL: CP000489.PE366

CP000489.PE366       Location/Qualifiers
FT   CDS_pept        344752..345042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68483"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY9"
FT                   /protein_id="ABL68483.1"
FT                   /translation="MLRSIGWTWGELPPGTFMIDEIRSGRNRGDQYATLRIKIYAGAGD
FT                   GFYFRFHEFGTKDGLPARPTFYPAWKAKRSGFRKKIRDRVRAAIRGVWRNG"
     atgctccggt cgatcggctg gacgtggggc gaactgccgc caggaacctt catgatcgac        60
     gaaattcgct ctggccgaaa tcggggcgac caatacgcga ccctgcggat caagatctac       120
     gccggtgcag gtgatggctt ctatttccgg ttccacgagt tcgggaccaa agacgggctg       180
     ccggcccgac cgaccttcta tccggcatgg aaggcgaagc gatctgggtt ccgaaagaag       240
     atccgcgacc gagttcgggc ggccatcagg ggggtatggc gcaatggcta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page