(data stored in ACNUC7421 zone)

EMBL: CP000489.PE369

CP000489.PE369       Location/Qualifiers
FT   CDS_pept        346245..349151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68486"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ2"
FT                   /protein_id="ABL68486.1"
FT                   /translation="MANEPDLLISAGFSDAQLVKEADKVVEFYRKKGQEAQKAFQDSQG
FT                   RVTNTQAARAHARELDRLAKSYDPVYRAAKRYEEELKRLDKALDVGAISQKRYADLVGQ
FT                   AARQMNLATGAIEQSSRKAAGGGNMLQQVGWQVGDFAVQVGAGTSAAQAFAQQAPQLLG
FT                   AMGAWGALAGAGVAVAVPLGAALLKVAMDTETLAEKLDSLNDTTKAYTDAAEAAVEPIS
FT                   VLRQKYGELADEVQRANGTMAMLASIRAQSDLFGAARSLGRELGINLNPMDVPLQADGA
FT                   INRDREYMAIQQRERAMERLRQRTGATADQADRLRMALNRTDSSNSLEAVVQDAANLLR
FT                   IIAELSGNEGADTMFLGGWAQQVDAVMKSAQKQIEATNKAQNDLLNSYDENTQKLKKLA
FT                   DDRRLAEEMLAVALKDGKADQIEAYGRVIKAIDKEVQAVKQSIAEMDGTFEASVKRMQE
FT                   LAGGLGGTINDAIKQWTGLNLREWGQAGAAANKGILDLIAQRESRGDYNATLDDGRWTG
FT                   GSRNLVNMTLKEIRALQEAMKTPENRALYGNGAGSSALGRYQIVGTTLDDLMKRLKLTG
FT                   DELFTPELQDRLATELLRQIKPGDVEGIRKVWAGLENVPAPLIQQAWGQQSIPRVDAEI
FT                   QKDLDKEIKDRERLAEQARRYGEQLAQNLLTEKESARLAAEQADQISAIKAQGLAPEDE
FT                   SRAIAAVTADIESQRVVLTLLADAKRRNVDLDAMLADGSMTYKQAIEALGEAKKADIIA
FT                   TNERAIAEGRLAETQQLMADAQQQTKQGLLDSIVAGESFADVLANVARMFAKAALEAAL
FT                   FNEGSWASGGGGKGLLGGLVNAIFKGWSVGGYTGPGGKHEPAGIVHKGEVVWSQDDVRR
FT                   AGGVGVVEALRRSSRLPGLADGGAAGMPMMQLSQIPFGLAAQRGPAVNATFAPNISIAP
FT                   GVTQAELAMTMAAAQREYEQKFLPMLQKHMPSYNERYT"
     atggcgaacg aacctgacct tctcatttct gccgggtttt ccgatgccca gttggtcaag        60
     gaggccgaca aagttgtcga attctatcgg aagaagggtc aggaggcgca gaaggcgttt       120
     caggattcgc agggacgcgt cactaatacg caggctgcgc gcgctcacgc cagagaactt       180
     gatcgactgg ccaagtcata cgatcctgtt tatcgcgccg caaaacgcta tgaggaggaa       240
     ctgaaacgcc tcgacaaagc gctggatgtc ggggcgatca gccagaagcg atatgcggac       300
     ctggtggggc aggctgcgcg ccagatgaat ctggcaacag gcgctattga gcaatccagc       360
     cgtaaggctg ccggcggcgg caatatgttg cagcaagtgg gctggcaggt cggtgacttt       420
     gctgttcagg ttggggctgg aacctctgct gcacaagctt ttgctcagca ggccccgcag       480
     ctcctcgggg caatgggtgc ttggggtgcg ctggcggggg ccggggttgc cgtggcggtt       540
     ccgctgggcg cggcgctgct caaggttgct atggacacgg aaacgcttgc cgaaaagttg       600
     gacagcctga acgatacgac caaggcttat actgacgccg ctgaagctgc cgtcgaaccc       660
     ataagcgtgt tgcgccagaa atatggcgaa ctggcagacg aggtgcagcg ggcaaatggc       720
     acaatggcga tgctggcctc cattagggcg caatccgatc tgttcggtgc cgcaagatcc       780
     ctcggtcgtg agctgggcat caatctgaat cccatggacg ttccgctaca agccgatggc       840
     gcgatcaata gggatcgtga gtatatggcg atccagcaac gggaacgcgc catggagagg       900
     ttgcggcaga gaaccggcgc cacggctgat caggcagatc ggttgcgaat ggctctgaac       960
     aggaccgaca gctccaatag cctggaagcg gtcgttcaag acgccgcgaa ccttctgcgc      1020
     atcattgccg aattgtcggg aaatgagggt gcggacacga tgttcctcgg gggatgggcg      1080
     cagcaggtgg atgccgtgat gaaatctgcg caaaagcaga tcgaggccac caacaaggcc      1140
     cagaacgacc tgcttaattc ctatgatgaa aatacgcaaa agctgaaaaa gctggcagat      1200
     gataggcgtc tcgcagaaga gatgctggcc gttgcgctta aggacggaaa agccgaccaa      1260
     atcgaagcct atggtcgggt gatcaaagcc atcgacaagg aggtgcaggc ggtcaagcag      1320
     tccatcgccg aaatggatgg cacattcgag gccagcgtga agcggatgca agaacttgcc      1380
     ggaggcctcg gtggcacgat caacgatgcc ataaagcaat ggaccgggct gaaccttcgc      1440
     gaatgggggc aggcgggcgc ggctgcaaac aagggtatcc ttgatctgat cgcgcaacga      1500
     gaaagccggg gcgattacaa tgccacgctg gacgatggtc ggtggacagg cggttcgcgc      1560
     aatctcgtca acatgacgct gaaagagatc cgcgcgcttc aggaagccat gaagaccccc      1620
     gagaatcggg cgctctacgg gaatggtgcc ggctcgtcgg ctcttggccg ttatcagatt      1680
     gtcggcacaa ccctcgatga tttgatgaag cggttgaaac tgaccggcga cgaactgttc      1740
     acgccggagc tacaggaccg ccttgctacg gagcttctgc gccagatcaa acccggcgac      1800
     gtcgagggta ttcggaaggt ttgggcaggg ctcgaaaatg tccctgcgcc cttgatccag      1860
     caggcgtggg gccagcaatc aatcccacgt gtagacgctg agatacagaa ggatctggac      1920
     aaggagatca aggaccgcga gcggcttgcc gaacaggcga ggcgatacgg tgagcagcta      1980
     gcccagaacc tcctgaccga gaaggaatcg gcgcgcttgg cggctgaaca ggctgatcag      2040
     atctccgcca tcaaggcgca ggggttggca cccgaggatg aatctcgtgc catcgcagcg      2100
     gtaaccgccg atatcgaaag ccaacgcgtg gtattgacgc tgctcgccga tgccaagcgc      2160
     cggaatgtcg atctcgacgc catgcttgcc gacgggtcga tgacctataa gcaggcgatt      2220
     gaggctctgg gtgaggcgaa gaaggccgac atcatcgcca ccaacgagcg tgcgattgcc      2280
     gagggccggc tggctgaaac gcaacagctg atggctgatg ctcagcagca gacgaagcag      2340
     ggtctgctgg actccatcgt cgcgggtgag agtttcgccg atgtgcttgc caatgtcgcg      2400
     cgcatgttcg ccaaggcggc gctggaagcc gcgctcttca acgaggggtc ctgggcatcc      2460
     ggtggcggcg ggaagggcct gcttggcggt ctggtcaatg ccatcttcaa gggttggtca      2520
     gtcggcgggt ataccggccc cggcggtaag cacgagccgg ccggtatcgt ccacaagggc      2580
     gaggtggtct ggtcgcagga cgatgtgcgg cgggctggcg gcgtgggcgt ggtcgaggcg      2640
     ctgcggcgca gttcgcgcct gcccggcctt gccgatggtg gcgcggcggg aatgcccatg      2700
     atgcagctgt cgcagatccc gttcggattg gcggcgcagc gcggcccggc agtcaacgcc      2760
     acctttgccc cgaacatcag catcgcgccc ggtgtcaccc aggccgaact ggccatgacc      2820
     atggcggccg cccaacggga gtatgagcag aagttcctac ccatgctgca aaagcacatg      2880
     cccagctaca atgagcggta tacctga                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page