(data stored in ACNUC7421 zone)

EMBL: CP000489.PE371

CP000489.PE371       Location/Qualifiers
FT   CDS_pept        349828..350394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68488"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ4"
FT                   /protein_id="ABL68488.1"
FT                   /translation="MSPELAAFLDSDPEVVPLVRLFHLNFGSVQYYLNETEVPLTFAGQ
FT                   LWQPSMGWIGADPLRLSANPFDANPAYYTVWNVGNKEGEDLAYEALNNPASWSDKLVRQ
FT                   LWAVRGFPDDAIVMHVGRIVDVKPRENVGLAEIRIRAETIAATRNYTPLGEYTDRDQQR
FT                   RHPGDLGCQHAASLVGKKIKGWLIG"
     atgagcccag agcttgccgc cttcctcgac agcgatcccg aagtggttcc gctggtcagg        60
     ctgttccatc tcaatttcgg gtcggtgcag tattacctca acgagaccga ggtgccgctg       120
     accttcgccg gccagctctg gcagccctcg atgggctgga tcggcgccga tcccctgcgc       180
     ttgtcggcca accccttcga cgccaacccg gcctattaca cggtctggaa cgtcggcaac       240
     aaggaaggcg aggatctcgc ctatgaggcg ctgaacaatc cggcctcctg gtcggacaaa       300
     ctggtgcgtc agctctgggc ggtgcgtggt tttcccgacg atgccatcgt gatgcatgtc       360
     ggccggatcg tcgatgtgaa gccgcgcgag aatgtcggcc tggccgaaat ccgcatccgc       420
     gccgagacca tcgccgcgac caggaactac acgccgctgg gcgaatatac cgaccgcgac       480
     cagcagcgcc gccatccggg cgacctcgga tgccagcatg cggcctccct ggtcggcaag       540
     aagatcaagg gatggctgat cggctag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page