(data stored in ACNUC7421 zone)

EMBL: CP000489.PE377

CP000489.PE377       Location/Qualifiers
FT   CDS_pept        complement(355711..355959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68494"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ00"
FT                   /protein_id="ABL68494.1"
FT                   /translation="MGLQPAAAGRKTRVMKATHDDKTFTLTGEIWSATYPLDELPKWLR
FT                   WYRSRKARFPKAGDAYDPTIAALEGLAAELGVEVSED"
     atggggttgc agccggcagc ggcgggtcgc aaaacgcgcg tcatgaaagc aacacacgac        60
     gacaagacct tcacgctgac cggcgaaatc tggtcggcca cctatcccct ggacgagctg       120
     ccgaaatggc tgcgctggta tcgcagccgc aaggcgcggt tcccgaaggc gggggacgcc       180
     tacgacccga cgattgcggc gctggagggg ttggcggccg agttgggcgt cgaggtcagc       240
     gaggactga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page