(data stored in ACNUC7421 zone)

EMBL: CP000489.PE381

CP000489.PE381       Location/Qualifiers
FT   CDS_pept        complement(357761..357928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68498"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ04"
FT                   /protein_id="ABL68498.1"
FT                   /translation="MEKIIATKVENIAPAITENTIAKFNAAMAEMCPMTDEERAEVEAT
FT                   WEAIFSALDD"
     atggaaaaga tcatcgccac caaagtcgaa aacatcgcgc ccgccatcac cgagaacacc        60
     atcgccaagt tcaacgccgc aatggccgag atgtgcccca tgaccgacga agagcgcgcc       120
     gaagtcgagg cgacgtggga ggcgatcttc tcggcccttg atgactaa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page